Conserved Protein Domain Family
PRK08334

?
PRK08334: PRK08334 
S-methyl-5-thioribose-1-phosphate isomerase
Statistics
?
PSSM-Id: 169386
View PSSM: PRK08334
Aligned: 7 rows
Threshold Bit Score: 709.809
Threshold Setting Gi: 240103613
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18977721    1 MEIKYRPEELTKLPRSVEYREGKVYMINQRLLPREFKVEEFTTVEAVAEAIKNMTVRGAPAIGAAAAFGLALYAETSKAK 80 
14590581    1 MEIRYTPKELTKLPRTVEYKNKSVYMINQRLLPKEFKVEKFSKVEEVAEAIKNMTVRGAPAIGAAAGFGLALYAETSKAK 80 
242399432   1 MGIKYKPEELTKLPRSVEFREGKVYLIDQLLLPREFKVIALEKVEDVARAIKTLQVRGAPAIGATAAYGLALLAEKSNAK 80 
212224083   1 MELKYKPEELTRLPRSVIYESGKVKLIDQRLLPREFKVIELTTVDEVARAIVTMQVRGAPAIGAAAAFGLALYAETTKAK 80 
14521540    1 MEVRYKPEELTKLPRSVEYKERTVYMINQRLLPREFKVEAFRTVESVAEAIKNMTVRGAPAIGAAAAFGLALYAETSKAK 80 
57640491    1 MEIRYKPEELTRLPRSVRYEPGRVTMIDQTLLPREFREIELRTVDEVAEAIITMKVRGAPAIGAAAAFGLALYADTSNAR 80 
240103613   1 MEIRYRPEELTRLPRSVRYETGKVIMIDQTLLPKEFKIIELRTVEEVAEAIITMKVRGAPAIGAAAAFGLALYADTTKAK 80 
18977721   81 TKDEFFDGFYRAYETLKNTRPTAVNLFWALNRIKKLVEEHREDSLDEIKRLIVEEAQKIADEDVEANLRMGHYGAEVLPE 160
14590581   81 TKEEFLDGFEKAYEILKNTRPTAVNLFWALNRIKKLVEEHSEDPLDEIKRLIVQEAYKIADEDVEANLRMGHYGAEVLPE 160
242399432  81 TKEKFFDEFYKAFEILKNTRPTAVNLFWALNRVKRLLEEHKENNLDTIKKLIIEEAHKIADEDVEANLRMGHYGAEILPE 160
212224083  81 TKDEFMDGFYAAYDKLKNTRPTAVNLFWALNRVKKLVEEHREDSLDEIKHLIVEEAQKIADEDVEANLRMGHYGAEVLPE 160
14521540   81 SKDEFMDGFYKAYETLKNTRPTAVNLFWALNRIKKLVEEHLEDPLDEIKSLIVNEAQKIADEDVEANLRMGHYGAEVLPE 160
57640491   81 TKEEFMDGFERAYERLKNTRPTAVNLFWALNRVKSLVEEHLEDPLDEIKRLIVAEAQKIANEDVEANLRMGHYGAEVLPE 160
240103613  81 NKDEFMDGFYRAYETLKNTRPTAVNLFWALNRIKKLVEENAESPLDELKKLIVAEAQRIADEDVEANLRMGHYGAEALPE 160
18977721  161 GNILTHCNAGSLATVHLGTVGAVVRVMHKEGTLKLLWLDETRPVLQGARLSAWEYSYDGLNVKLIADNAAAFVMQQGKVD 240
14590581  161 GNILTHCNAGSLATVHLGTVGSVVRVMHKDGSLKLLWLDETRPVLQGARLSAWEYSYDGLNVKLIADNAAAFVMQQGFVD 240
242399432 161 GNVLTHCNAGSLATVHLGTVGAALRVMHREGKLKLLWVDETRPVLQGARLSAWEYHYDGIPLKLISDNMAGFVMQQGKVD 240
212224083 161 GNVLTHCNAGSLATVHLGTVGAVLRVMHKEGTLKLLWVDETRPVLQGARLSAWEYHYDGIPLKLISDNMAGFVMQQGKVD 240
14521540  161 GNLLTHCNAGSLATVHLGTVGAVVRVMHKDGSLKLLWLDETRPVLQGARLSAWEYSYDGLNVKLIADNAAAFVMQQGLVD 240
57640491  161 GNVLTHCNAGSLATVQLGTVGAVLRVMHRDGTLKLLWVDETRPVLQGARLSAWEYHYDGIPLKLISDNMAGFVMQQGKVD 240
240103613 161 GNVLTHCNAGSLATVQLGTVGAVLRVMNKDGTLKLLWVDETRPVLQGARLSAWEYHYDGIPLKLITDNMAGFVMQQGKVD 240
18977721  241 AIIVGADRIVANGDFANKIGTYMLAVLAKEHGIPFFTVAPLSSIDMSLSSGKEIPIEERSPEEVLTCGGCRIAPDVPVYN 320
14590581  241 AIIVGADRIVANGDFANKIGTYMLAVLAREHGIPFFAVAPLSSIDMELKSGKDIPIEERSPEEVLTCGGCRIAPDVPVYN 320
242399432 241 AIIVGADRIVANGDFANKIGTYSLAVLAKEHKIPFFTIAPISTVDMNLKSGKEIPIEERPKEEVLTCGGCKIAPDVDVYN 320
212224083 241 AIIVGADRIVANGDFANKIGTYTLAVLAKEHGIPFFTVAPLSTIDMSLKSGKEIPIEERSKEEVLTCGGCRIAPDVDVYN 320
14521540  241 AIIVGADRIVANGDFANKIGTYMLAVLAREHGIPFFAVAPLSSIDMSLKSGKEIPIEERSPEEVLTCGGCRIAPDVPVYN 320
57640491  241 AIIVGADRIVANGDFANKIGTYTLAVLAKEHGIPFFTVAPLSTIDMSLKSGKEIPIEERKPEEVLTCGGCKIAPDVDVYN 320
240103613 241 AIIVGADRIVANGDFANKIGTYTLAVLAKEHGIPFFTVAPLSTIDMSLKSGKEIPIEERKPEEVLTCGGCRIAPDVDVYN 320
18977721  321 PAFDVTPHKYLTGIITDRGVVWPPFKRNLKKLFETL 356
14590581  321 PAFDVTPHKYLTGIITDRGVVWPPFKRNLKKLFEVN 356
242399432 321 PAFDVTPHKYLTAIITDRGVVYPPFERNLKKIFE-- 354
212224083 321 PAFDVTPHKYLTGIITDRGVVYPPFERNLKRLFKRE 356
14521540  321 PAFDVTPHKYVTGIITDKRVVWPPFKRNLKKLFGEQ 356
57640491  321 PAFDVTPHKYLTGIITDQGVVWPPFERNLKKLFKRE 356
240103613 321 PAFDVTPHRYLTGIITDRGVVYPPFERNLRRLFREE 356
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap