Conserved Protein Domain Family
PRK08330

?
PRK08330: PRK08330 
biotin--protein ligase; Provisional
Statistics
?
PSSM-Id: 169384
View PSSM: PRK08330
Aligned: 7 rows
Threshold Bit Score: 371.384
Threshold Setting Gi: 57640922
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
240103812   1 MEWNIITLDEVDSTNEYARriAPTAPEGTVVVAKRQTAGRGRKGRRWASPEGGLWMTVILKPKSGPEHVTKLVFVGALAV 80 
14520365    9 IGRTIIYFQEVASTNDYAK--AENLEEGTVIVADRQIKGHGRLERKWESPEGGLWMSVVLTPRVSQEDLPKIVFLGALAV 86 
212224051 105 IGRKIIHFHEVDSTNEYAKliALDEREGTVVVADRQTAGKGRKGRTWASPEGGLWMSVILKPKAEPKHLSKLVFIGALAV 184
57640922    1 MEWNVIRLDEVDSTNEYAKklIPDVSEGTVVVAKRQTSGRGRKGRAWASPEGGLWMSVILKPPMID---PRLVFVGALAV 77 
18976449    9 IGKVVIYYREVTSTNEVAK--LGNFEEGTVIVADTQTMGHGRIGRRWESPPGGLWMSVVLHPRISTEDLPKLSFLGALAV 86 
242398221   9 IGKKIIYFKKIDSTNEYAKriAAHEEEGTVIVADVQETGYGRKFRAWASPQGGLWMSVILKPNTTPEHMIKLVFLGALAV 88 
14590088    9 IGRRVIYFQEITSTNEFAK--TSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGV 86 
240103812  81 LDTLHEYGIRGELKWPNDVLVDGKKIAGILSECRlNH----FALLGIGLNVNNEIPDElresAVSMKEVLGRAIDLEEVL 156
14520365   87 VETLREFSIDARIKWPNDVLVNYRKVAGVLVEAK-GE----KVILGIGLNVNNKVPDG----ATSMKQELGSEIPMLNVF 157
212224051 185 VDTLWKFGIEAGIKWPNDVWVNGRKICGVLTEGRiGE----FVILGIGLNVNNDAPEElrkmATSMREFLGREVSLSEVF 260
57640922   78 SDTLRDFGIGAWIKWPNDVWVGNRKISGVLTEVK-GD----FVIMGVGLNVNNEIPDGlketATSMMEALGEPVDIGEVL 152
18976449   87 VRTLSEFSIQGKIKWPNDVLVDYKKIAGILVEKR-GD----NVVLGVGLNVNNEAPEN----ATSMAEILGTSVPLIEVF 157
242398221  89 VETLEQLGIEGKIKWPNDVLVNEKKICGILVEGSfSEkevyYIVLGIGMNVNNSLPQElvstSTSLREVLGVEIPIIEVF 168
14590088   87 VETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGK-GD----KIVLGIGLNVNNKVPNG----ATSMKLELGSEVPLLSVF 157
240103812 157 NRVLRNLSRWYGLFRNGRhGEILkAVKGSSAVLGKRVRIIEDGEIIAEGIAVDIDNSGALILKGEENTV-RVLYGDVSLR 235
14520365  158 KTLVKTLDSLYLKFLESP-GKIL-ERAKRSMILGVRVKVLSDGEVEAEGIAEDVDEFGRLIVRLDDGRVkKILYGDVSLR 235
212224051 261 HALIRNLDHWYRLFLNGRyAEIIsALKERSIVLGKEVKIIDDETELV-GRAVDIDVDGALILETPKGRV-RVLHGDVSLR 338
57640922  153 ERLLEYLGRWYKTFLENP-PLVVeEVRGRTMLIGKEVRVLLDGNDLV-GRVITISDDGSLILDVDGQTV-KVVYGDVSVR 229
18976449  158 RALVTNLDELYKMFLSSP-ASLL-EMAKKEMILGVPVRIIGDGEI--EGIAEDIDELGRLILRLSDGSLkKIVYGDVSLR 233
242398221 169 KILVERLEHWYREFLAGK-DALIlQKWRENAILRRKVKLITEDKTLT-GKALDIDEFGALILELEDGKKeKILYGDVSLR 246
14590088  158 RSLITNLDRLYLNFLKNP-MDIL-NLVRDNMILGVRVKILGDGSF--EGIAEDIDDFGRLIIRLDSGEVkKVIYGDVSLR 233
240103812 236 FS 237
14520365  236 FL 237
212224051 339 FL 340
57640922  230 IN 231
18976449  234 FL 235
242398221 247 FE 248
14590088  234 FL 235
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap