Conserved Protein Domain Family
PRK08328

?
PRK08328: PRK08328 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 169382
View PSSM: PRK08328
Aligned: 7 rows
Threshold Bit Score: 384.533
Threshold Setting Gi: 240102232
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
57642052    1 MLTERELERYDRQIMIFGEEGQEKLKGAKVAVVGVGGLGSPVAYYLAAAGIGTVLLIDEQTPELSNLNRQILHWEEDVGR 80 
240102232   1 MLTDRELQRYNRQIMIIGTEGQERLKGSTVAVVGVGGLGSPVALYLTAAGVGRIVLIDSEKPELSNLNRQILHWEEDLGA 80 
14590009    1 MLSERELERYDRQIMLFGVEGQEKLKRAKVAVAGVGGLGSPVAYYLVAAGVGRVLLIDDQIPELSNLNRQILHWEEDVGK 80 
242399828   4 MIGKKEVERYDRQIRIFGVEGQEKLKKSKVAVVGVGGLGSPVAYYLAAAGVGELLLIDCQTPELSNLNRQILHWEEDLEK 83 
212224773   1 MLSERELERYDRQIMIFGKEGQEKLKNSKVAVVGVGGLGSPVAYYLAAAGIGTLLLIDEQTPELSNLNRQVLHWEEDLDK 80 
18976381    1 MLSERELERYDRQIMIFGIEGQEKLKKANVAVVGVGGLGSPVAYYLAAAGVGTILLIDEQTPELSNLNRQILHWEEDIEK 80 
14520281    1 MLSESELERYDRQIMIFGVEGQEKLKKAKVAVVGVGGLGSPVAYYLTAAGVGRILLIDEQVPELSNLNRQILHWEEDLGR 80 
57642052   81 RSKPESAKWKLERFNSDIKIEAYTGRLTAENIDEVLKDVDIVVDCLDNFQTRYLLDEYVHRKRIPLVHGAVEGMHGQVTT 160
240102232  81 RPKPLSGKWKLERFNSDVEVVARPVRLSEENIDEVLKDADVIVDCLDSFEARFLLDDYAKRTGKPLVHGAVEGTYGQVTT 160
14590009   81 NPKPLSAKWKLERFNSDVRVETYVGKLTEENVNEVLDGVDVIVDCLDNFETRYLLDDYAHKVGIPLVHGAVEGMYGQVTT 160
242399828  84 NPKPISAKWKLERFNSDIKISTFTGILNVKNIEEVLKDIDVIVDCLDNFETRYLLDEFAHKKGIPLVHGAVEGLYGQVTT 163
212224773  81 NSKPISAKWKLERFNSDIKIETFVGRLSEENIDEILEGVEVIVDCLDNFETRFLLDDYAQRKKIPLVHGAVEGTYGQVTT 160
18976381   81 NPKPISAKWKLERFNSNIKIETFVGRLSEENIDEVLSGVDVIVDCLDNFETRYLLDDFAHKKGIPLVHGAVEGFYGQVTT 160
14520281   81 NPKPLSAKWKLEKFNSDVKIETFVGKLTEENIEDVLHGVDVIVDCLDNFETRYLLDDYAHKVGIPLVHGAVEGLYGQVTT 160
57642052  161 IVPGITKSLREIFPKVREKEEKFPIIGATAGVVGSIQAMEVIKLLTGIGEPLLNKLLLIDLAMNIFEVVEL 231
240102232 161 ILPGKTKTLREIFPRVKEKKGKLPIIGPTAGVVGSIQAMEVIKLLTGLGEPLFNRLLIIDLAHNVYELVEL 231
14590009  161 IVPGKTKRLRDIFPKI-KKTGKFPILGATAGVIASIQVAEVVKLITGYGEPLLNKLLLVDLANNIFEIVEI 230
242399828 164 VIPGETKGLRDLFPTPPRKKENFPILGATAGVIGAIQVAEVIKLITGYGAPLANKLLIVDLMHNSFEVVDL 234
212224773 161 IVPGFTKSLREIFPNVGRKKEKFPILGATAGVIGTLQAMEVVKLLTGIGEPLLNKLLIVDLAFNTFDVVEL 231
18976381  161 IIPGKTKRLREIFPKV-KKKGKFPIVGATAGVIGTIQASEVIKLITGYGEPLANKLLIIDLANNTYEIIEI 230
14520281  161 IIPGKTKRLREIFPRI-KKKGKFPILGATAGVIGSIQVTEVVKLITGYGEPLANKLLIVDLANNVFEIIEI 230
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap