Conserved Protein Domain Family
PRK08201

?
PRK08201: PRK08201 
dipeptidase
Statistics
?
PSSM-Id: 169276
View PSSM: PRK08201
Aligned: 7 rows
Threshold Bit Score: 845.566
Threshold Setting Gi: 51892376
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
56965721    1 MASSVIERLRQDRAAHLEELSAFLKIPSISSISEHKEDIRAAAEWLKQAFLQAKMEKVEIIETKKHPIVYAEWLDAgPEA 80 
258512339   3 AIREVESYLERERDALLEELKELLSIPSVSALSEHRGDVRRAAEWIAERLKSAGFEHVELMETGGHPLVYADWLHA-DGR 81 
169826462   3 NLQQIDAYFAEHREAHLNELKEFLQIPSISSLSEHKEDIQHAAQWLANAFEKLNLENISITQTAGHPVVYADWLHA-EGK 81 
51892376    1 -MQQVEAYLRERRDEHLRQLMDFLRIPSVSALSEHRSDVRRAAEWLAAELRRIGLNRVEVMETGGHPVVYAERLDN-PGG 78 
251798684   1 --MSYESYFSERREQQLEELKEFLRIPSISALSEHKQDMIKAAEWVAGKLEAAGLENVKIHQTAGHPIVYADHLHA-PGK 77 
15616437    1 -MNDVRTYLEQKREEHLDELKQLLAIPSVSALSEHKEDVRKAAAWFVDTLQKAGLEHVEMIETKGHPLVYADWLHA-KGK 78 
261408495   1 MSVDYKAYFAEHRETHLNELKEWLSIPSISALSEHKGDVAKAAEWLAGKLTEAGLEHVEVHQTAGHPIITADYLHA-EGK 79 
56965721   81 KTILIYGHYDVQPVDPLHLWETEPFEPTVRDGKLYARGASDDKGQVFMHLKAVQTMLEVEGTLPFNVKFLIEGEEEIGSP 160
258512339  82 PTVLVYGHYDVQPVDPVELWESPPFTPTVRGNKLYARGASDDKGPTFLHIAVLSAMLKVQGRLPVNVKFCIEGEEEVGSA 161
169826462  82 PTILFYGHYDVQPVDPLNLWESEPFNPTIRDNKLFARGASDDKGQVFMHLKMIEALFATTGTLPVNVKFIYEGEEEIGSP 161
51892376   79 PTALIYGHYDVQPVDPIELWTTPPFEPDIRDGKLYARGASDDKGQVFMHLKVIEALLAAEGRLPVNVKLLIEGEEEVGSE 158
251798684  78 PTVLVYGHYDVQPVDPLNLWETPPFEPTERNGKLYARGATDDKGQVFLHIKAVEALLKQEQQLPVNVKFCIEGEEEISSP 157
15616437   79 PTVLIYGHYDVQPVDPINLWETPPFEPSIREGKIFARGATDDKGQTFMHIKALEALLKTEGTLPVNVKLIIEGEEEIGSP 158
261408495  80 PTVLVYGHYDVQPVDPLHLWETPPFEPAVRNGKLYARGATDDKGQLFLHVKAVEAILKQEKELPVNIKFCIEGEEEVSSP 159
56965721  161 NLDEFVANEKERLAADVLLISDTTMLEAGKPAICSGLRGIAALEIRVKGAKGDLHSGLYGGAVQNALHALVQLLASMRDE 240
258512339 162 HLHSFLERTRDKFRADLVLISDTTLVGPNQPAVVYGLRGLAAAQIDVRTAASDLHSGLYGGAVPNAARSVAEIVASFHRP 241
169826462 162 HLPSFVEEYKEKLASDLILISDTGLYGPGKPAVCYGLRGLAGIQIDVRGAKGDLHSGLYGGGVQNAIHALAEILASFRDE 241
51892376  159 NLERFIAAHRDLLKADVVVISDTALYARGVPSLTYALRGLAALEVHVIGAKGDLHSGAFGGAAPNAAQALVQLLATLHRP 238
251798684 158 SLLTFLNEKQELLATDAVLISDTSLIEKGKPAISTGLRGLCSLELTINASNTDLHSGTYGGGVPNALHAMVELLASLHDK 237
15616437  159 NLDPFVEQEQNKLQADVLVISDTPMLGKGKPAICTGLRGLCSLQIDVKGTKGDLHSGLYGGAVQNSVHALVQLLDSMRNE 238
261408495 160 NLPLYLDNNKDKLAADAIVISDTSLLAPGKPAISTGLRGLCSLELSLETANTDLHSGTYGGGVPNALHAMVSLLSSLHDE 239
56965721  241 NGKITIDGFYEGIEIPSAEEMESIKALGSGEEALKEELGVNELFGEKGYTARERTWIRPTLELNGVYGGFQGEGVKTVIP 320
258512339 242 DGTVAVEGFYDRVRPLTEAEREEFAKLGHDEGELKRSLQLADLWGEPGYTALERMCARPTLEVNGIWGGFQGEGTKTVIP 321
169826462 242 HGTIQVEGFYDNVLPLTEEEREAYRALGFDEESVKQEVGVKELFGEQGFTYLERTWARPTLEVNGVFGGFSGEGIKTVLP 321
51892376  239 EGGVAVAGFYDQVRPLTPEEREGFAALGFDEEKLKADLGVDALPGEPGYTALERLWARPTLEINGIFGGFQGEGTKTVIP 318
251798684 238 HGRITVEGFYEGVPELTAAMHEEFEKQKFNEEQLKKTLGLGTLYGEEGYTFVERTGARPTLELNGVWGGFQGEGTKTVIP 317
15616437  239 KGQVMVEGFYDDVVDASPEERESFARLDHHDDEMKDELGVTELFGEEGFSTLERTWIRPTLEINGIYGGFQGEGVKTVIP 318
261408495 240 QGRVAVEGFYDGVLELSPEMREEFAKQQFDEDKLKRDLGLDSLYGEEGFSFVERVGARPTLELNGVYGGFQGEGSKTVIP 319
56965721  321 AEATAKITCRLVPGQDPIDILEKIEAHIQAHTPPGVTVTTERHDTGKPFVAPVTDPVFAACARAYEEVYQTEVAYTRMGG 400
258512339 322 CEAHAKITCRLVPDQDPQEILDLVERHVQAHAPKGARVTFVRQDGGKPYVAPYDHPALQLAASAYEHAYGQKAVFTRMGG 401
169826462 322 AEAGAKITCRLVPNQEPDEIVALLKAHVEKHKPAGVEINISEFDKGPAFLTPFDHPFIQAAGRSYEKVYNVPTAYTRGGG 401
51892376  319 ARAGAKITCRLVPDQDPERVLDAIEAHLKAHCPAGVRLEIRRMGGTPAAITPIDHPAIRAAMQALSDAYGAEARFIRTGG 398
251798684 318 KEAHAKITCRLVGQQDPQRILDAIIAHLHANVQQGVTLSVKPGEKARAFDMDPTIPLLQTAADAYEAVYGTRALFTKDGG 397
15616437  319 SEAHAKITCRLVPDQDPHQIASLIEKHIEGHTPLGVKVTTTRFDTGRPFAASIDHPAIQAAARSYEAIYGEPAVFTRMGG 398
261408495 320 KEAHAKITCRLVADQDPQAVLDAIEKHLHAHTPVGAKITFQPKEKAFAFNIDPSHPMLQKAADAFENVYGSRALFTKDGG 399
56965721  401 SIPVVETFDSQLHIPIVLMGFGLPSENFHAPNEHFHLENFDKGMETIVAFWNQYANR 457
258512339 402 SIPVVETFSTLLHIPIVMMGFSLNDENFHAPNEHFSLDNFDKGLRTLTYYYHQLPAA 458
169826462 402 SIPIVAAFDEILEIPVVLMGFGLSSENFHAPNEHFHLENFDKGLRVLSDYLYEVSEL 458
51892376  399 SIPVVGTFGAVLGTPCVLMGFSLEEENFHAPDEHFHLENFDLGMRALSRFWHYLAEG 455
251798684 398 SIPIVETFSRQLSAPVIMMGFGLPDENLHAPNEHFNLENFDKGLLTIVEFLKRV--- 451
15616437  399 SIPVVETFHRLMKLPIVLMGFGLPSENFHAPNEHFHLENFDKGLVTLCHYWHELANI 455
261408495 400 SIPIVEKLSSTLNAPAVMMGFGLPDENLHAPNEHFNLENFDKGLLTIVEYLKLV--- 453
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap