Conserved Protein Domain Family
PRK08192

?
PRK08192: PRK08192 
aspartate carbamoyltransferase; Provisional
Statistics
?
PSSM-Id: 169269
View PSSM: PRK08192
Aligned: 28 rows
Threshold Bit Score: 660.267
Threshold Setting Gi: 71279507
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
192361045   1 MNFTGAHILSIQQFQREDINRIFDVADAMEPYALRRRVTRVLEGAILGNMFFEPSTRTRVSFGAAFNLLGGNVRETTGFE 80 
127511946   2 TQFQGSHILSVNQLNLDAVQEIFSVASRMTPYALRRKRTTVLDGAILGNLFFEPSTRTRVSFGSAFNLLGGKVNETVGIG 81 
212633989   2 TQFQGSHILSVNQLNLDAVQNIFDVATRMTPYALRQKRTTVLDGAVLGNLFFEPSTRTRISFGCAFNLLGGKVNETVGMA 81 
157960803   2 TQFQGSHILSVNQLDLEAVEKVFSVATRMTPYALRQKRTTVLDGAVLGNLFFEPSTRTRVSFASAFNLLGGRVNETVGMA 81 
196155308  19 SDFTGNHILSVNQFDREAIEKVFSVANSMKPYATRQKRTTVLDGAILGNLFFEPSTRTRVSFGTAFNLLGGEVRETTGMS 98 
254786918   1 MQFPGAHILSVEQFDRADIERIFAVADSMEPYALRRRVTRVLEGAILGNMFFEPSTRTRVSFGCAFNLLGGEVRETTGFK 80 
71279507    2 MKFQGNHILSVSQFDREAIAKILQVSAQMAPYASRKKRCHVLDGAILSNLFFEPSTRTRVSFGTAFNLLGGFVRETVGQE 81 
77361177    2 LSFQGENILSVNQLDRDCIERIFAVAKKMEPYAKKQKRTNVLEGAILANLFFEPSTRTRVSFGTAFNLLGGLVRETTGMQ 81 
109896825   1 MKFEGSHILSVNQFDRESIERVFDVANQMEPYAKRQKRTTVLDGAILGNLFFEPSTRTRVSFGTAFNLLGGEVRETTGMS 80 
56461344    1 MNFTGSNILSVNQFNRDSIDYIFSVADKMQPYARRKTRTRVLDGAILGNLFFEPSTRTRVSFGTAFNLLGGEVRETTGME 80 
192361045  81 SSSLTKGESLFDTARVLSGYSDVICMRHPAAGSVAEFAEGSRVPVINGGDGPNEHPTQALLDLYTIRKELRSKGRGIDDL 160
127511946  82 TSSLSKGESLYDTARVLSSYSDVIAMRHPDAYSVREFAEGSRVPVINGGDGPNEHPTQALLDLFTIQKELAAGGRSISGM 161
212633989  82 SSSLSKGESLYDTARVLSSYSDVIAMRHPEAFSVKEFAEGSRVPVINGGDGSNEHPTQALLDLFTIQKELASGGRDISGM 161
157960803  82 SSSLSKGESLYDTARVLSSYSDVIAMRHPDSFSVSEFAKGSRVPVINGGDGSNEHPTQALLDLFTIQKELAAGGRDISGM 161
196155308  99 SSALAKGESLYDTARVLSGYSDIIAMRHPAAGSVAEFAEGSRVPVINGGDGANEHPTQALLDLFTIKRELEYNGHGIDGL 178
254786918  81 SSAIAKGESLYDTARVLSGYSDVICMRHPEEGSVAEFASASRVPVVNGGDGANEHPSQALLDLYTIQKEVRAKGGSMDSL 160
71279507   82 NSSLSKGESLFDTAQVISGYSDVIAMRHPQMHSVEQFAQGSSVPVINGGDGANEHPTQALLDLFTIQSEMMHFNKGLDDL 161
77361177   82 SSALAKGESLYDTARVISAYADAVAMRHPDAGSVSEFATGCSIPVINGGDGPNEHPTQALLDLLTIERELNRFEQNIDGM 161
109896825  81 NSALAKGESLYDTARVLSGYSDIITMRHPDSGSVAEFAQGSRVPVINGGDGANEHPTQALLDLYTIQKELLYHGGNIDGL 160
56461344   81 SSAIAKGESLYDTARVLSSYSDVIAMRHPKSGSVKEFAEGSRVPVINGGDGANEHPTQALLDLYTIQKELAYHQQSIDNM 160
192361045 161 RIAMIGDLKHGRTVHSLCKLLGLFNNVSITLVSPKELAMPDYIVEDLRQAGHKVTITDDLPTSITHIDIAYSTRIQEERF 240
127511946 162 HIAMVGDLKFGRTVHSLSRLLCMYKDVSFTLISPKELAMPDYVIDDIENAGHKITITDQLEGNLDQADILYLTRIQEERF 241
212633989 162 HIAMVGDLKFGRTVHSLSRLLCMYKDVSFTLVSPKELAMPDYVINDIENAGHKITITDQLEGNLDRADILYLTRIQEERF 241
157960803 162 NIAMVGDLKFGRTVHSLSRLLCMYKDVSFTLVSPKELAMPDSVINDIANAGHKITITDQLEGNLDRADILYLTRIQEERF 241
196155308 179 HIAMIGDLRYGRTVHSLSRLLCLFNNIRFTLISPKELAMPQPIIDAIENAGHQLTITDTLEGNMD-ADICYQTRIQEERF 257
254786918 161 RIAMIGDLKYGRTVHSLSKLLALYDRVEVALVSPQELAMPEKYVETLRAAGHKVTVSSELSQSISSVDIVYSTRIQEERF 240
71279507  162 NIVLMGDLKHGRTVHSLSKLLSLYDNVKVTMVAPKALQMPDSVISTLSDAGHEVILTETMAGNLS-ADVIYQTRIQQERF 240
77361177  162 HIALVGDLKYGRTVHSLSKLLCHYKNVKFSMVAPDGLQMPSYILDAVDNAGHKIELVNKMEGNLA-ADIVYQTRIQEERF 240
109896825 161 HIAMIGDLKYGRTVHSLSKLLCLFKNIRFTLISPKELAMPDAILSAIENAGHSYTISETLEGNFD-ADICYQTRVQEERF 239
56461344  161 HICMIGDLKYGRTVHSLSTLLSMYKNIKFTLISPRELSMPGSVLDTLENAGHRVTVTEKVDGIVD-ADIVYQTRIQQERF 239
192361045 241 ASKEEADSYRGRFRLNQAIYTQFCEPNTVIMHPLPRDSRAEANELDNDLNTNPNLAIFRQADNGVLVRMALFALVLDVAD 320
127511946 242 PSQEEANKYRGKFRLNHNIYTQHCKSNTVIMHPLPRDSREQANELDNDLNSHPNLAIFRQADNGLLIRMALFALTLGVDS 321
212633989 242 PSQDEANKYRGKFRLNQSIYTKHCKSNTVIMHPLPRDSREQANELDNDLNNHPNLAIFRQADNGLLIRMALFALTLGVDS 321
157960803 242 PSQEEANKYRGKFRLNQSIYTQHCKSNTVIMHPLPRDSREQANELDNDLNDHPNLAIFRQADNGLLIRMALFALTLGVDS 321
196155308 258 PSQEEANKYRGKFRLNQSIYTKHFQSKTVIMHPLPRDSRMEANELDNDLNLNPNLAIFRQTDNGVLVRMALFALTLGVEN 337
254786918 241 ASKAEADLYRGRFRLNQAIYTQFCQPNTVIMHPLPRDSRADANELDTDLNQNPNLAIFRQTDNGILVRMALFAMILDVVD 320
71279507  241 ASKDEAELYRGHFSLNKSVYQKYCQENTVIMHPLPRDSRPEANELDTDLNDLDNLAIFRQAQNGVLVRMALFALTLGVED 320
77361177  241 PSQEEANKYRGGFRISQSIYTAHCKPNSVLMHPLPRDSRLEANELDNDLNANDNLAIFRQVQNGVLIRMALFALTLGVEN 320
109896825 240 GSQEEANLYRGKFRLNQQIYTKHFQSKTVIMHPLPRDSRTEANELDNDLNMNPNLAIFRQTDNGVLVRMALFALTLGVEN 319
56461344  240 ASPEDADQYRGKFRLNQDIYTKHYKPNTVIMHPLPRDSRAEANELDNDLNQNPNLAIFRQADNGVLIRMALFALTLGVVD 319
192361045 321 QVDKYAREVRWFSSLRAN 338
127511946 322 QLEQHECPVNWYSQKADF 339
212633989 322 QLEQYERPVNWYSRKAEF 339
157960803 322 QLEQYERPVNWYSRKADV 339
196155308 338 LLTKYERDVVWYSNKSK- 354
254786918 321 QVDKHARDVNWYHNRDLN 338
71279507  321 QLTDYEKPVNWFTNKNA- 337
77361177  321 KVEQYEVDVPWFSRKRDS 338
109896825 320 IVSKFDKEVHWYSGH--- 334
56461344  320 QVDKHQCDVIWYSEKSQQ 337
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap