Conserved Protein Domain Family
PRK08182

?
PRK08182: PRK08182 
single-stranded DNA-binding protein; Provisional
Statistics
?
PSSM-Id: 169261
View PSSM: PRK08182
Aligned: 40 rows
Threshold Bit Score: 168.707
Threshold Setting Gi: 120611352
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116052596   1 MATPVFWEGNIGSAPEHRSFPNGNNPPRQLLRLNVMFDNSIPDGQGG-YKDRGGFWCSVEWWHQDAQRFAELFTKGMRVK 79 
152986084   1 MATPVFWEGNIGSAPEHRSFPNGNNPPRQLLRLNVMFDNSIPDGQGG-YKDRGGFWCSVEWWHQDAQRFAELFAKGMRVK 79 
70732009    1 MGTPVVWEGNIGNPPEHKSFPNGNNEPRQLLRLNVMFDNSIPDGSGG-YKDRGGFWANVEWWHPDAERFAQLFSKGMRVV 79 
66044769    1 MGTSVDWEGNLGSAPEFKEFANGNKDPRRLLRLNVYFDNSIPKADGSgFEDRGGFWANVEYWHRDAEHYANLFQKGMRVM 80 
21242946    1 MSTHFHGEGNIGSPPKFDEYPNGNEEPRRVLRLNVYFDNPVQNKDGA-YDDRGGFWAPVDWWHRDAERWATLFAKGMRVA 79 
120611352   1 MQNLFIGKGNLANSPELRQI-TGRNGDFEVASMRVYFGRYGQTEDGE-VGQVGGFWREVEIYGQKARDVARHLRRGARVL 78 
120609260   1 MSTHFHGEGNIGSPPKFDEYPNGNEEPRRVLRLNVYFDNPVPGSDGT-YDDRGGFWAPVDWWHRDAEHWATLFAKGMRVV 79 
241662257   1 MSTHFVGEGNIGSAPDYREFHNGNDEPRRLLRLNVYFDNPIPKKDGE-FEDRGGFWAPVELWHRDADHWKDLYQKGMRVL 79 
261820950   1 MSTHFSGEGNIGSAPEFHEYPNGNEEPRRVLRLNVYFDNPVPGKSGA-FEDRGGFWRPVDWWHRDAEQFAELFQKGMRVV 79 
251788116   1 MGTHFSGEGNIGSAPEFHEYPNDNEEPRRVLRLNVYFNNPVPGKDGT-FEDHGGFWQPVDWWHRDAEQFAELFQKGMRVV 79 
116052596  80 VEGRAIMDRWPDKESGEEVqALKVEASRISILPHRLAEVTLLPTQHQQSRNVPQQPAQQDAQSQQDYDSA 149
152986084  80 VEGRAIMDRWPDKESGEEVqALKVEASRISILPHRLAEVTLLPSTNGQSTQHQQSRQVPPQPAQQDAQSQ 149
70732009   80 VTGRAIMDTWKDKETGDDVwALKVEANRVAILPHRVNQVTMTQSNNTGQRQNAQQNNRPERQQNSAQQPG 149
66044769   81 IQGRAIIDNWTK-DGKEFS-ALKVQASRVAILPHRVEAVQLAPSQSYNQPQSEQQHTDRNSTQNDAAPHF 148
21242946   80 VRGHLERDDWTDGDGEPHT-TYKVDARSVGILPYRLDAVHLSPKPGTTGE-------------------- 128
120611352  79 VIG--EEREFTARGDNGEVeVIKVVAEDVALQLTRIEQIVFKARRDATEPEGEVPA-------------- 132
120609260  80 VRGRMIRDQWTDDEGQPRT-TYKVDARSVAILPYRLDSVELSPKTAAGDE-------------------- 128
241662257  80 VEGRTVKDEWEDADDNERT-TFKIEARRVGILPYRLQAVTLSARTLEP-EAAVPPPKETKGTKAPKETKA 147
261820950  80 VSGRVERDDWTDENNNPRT-TYRINARSVGILPYRIEAIILSPKPGAADPVSQAE--------------- 133
251788116  80 VSGRVERDDWTDENNNPRT-TYRVNARSVGILPYRIEAIILSPKPGSADPLQPNE--------------- 133
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap