Conserved Protein Domain Family
PRK08181

?
PRK08181: PRK08181 
transposase; Validated
Statistics
?
PSSM-Id: 136670
View PSSM: PRK08181
Aligned: 18 rows
Threshold Bit Score: 496.759
Threshold Setting Gi: 146279516
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
167621681   1 MKPADPIDAGRLTLALNELRLPAIKTIWPDFAVRADKEGWPAARFLAALTEHELAERASRRIQRHLDEARLPPGKTLDGF 80 
27380110   13 MSTTNVVDTARLNLLLNELRLPAIKALWPQFAEQSDKEGWPAARFLATIAEHEIAERGRRRIERHLVEARLPTGKTFDSF 92 
27378637   13 MSTTNVVDTARLNLLLNELRLPAIKALWPQFAEQSDKEGWPAARFLATIAEHEIAERGRRRIERHLVEARLPTGKTFDSF 92 
27377107   13 MSTTNVVDTARLNLLLNELRLPAIKALWPQFAEQSDKEGWPAARFLATIAEHEIAERGRRRIERHLVEARLPTGKTFDSF 92 
27377010   13 MSTTNVVDTARLNLLLNELRLPAIKALWPQFAEQSDKEGWPAARFLATIAEHEIAERGRRRIERHLVEARLPTGKTFDSF 92 
27376818   13 MSTTNVVDTARLNLLLNELRLPAIKALWPQFAEQSDKEGWPAARFLATIAEHEIAERGRRRIERHLVEARLPTGKTFDSF 92 
227818790   2 KNVHNTIDEARLGIMLNDLRLPTIKTLWPQFAEQADREGWPAARFLSAIAEHELAERAHRRIERHLAEAHLPPGKTLESF 81 
146279516   1 MSTSEPIDEARLGLLLGDLRLPTIKHIWPAFAERADKEGWPAARFLTALAEHEIAERARRRIERHLTEAHLPPGKTLDGF 80 
146276989   1 MSTSEPIDEARLGLLLGDLRLPTIKHIWPAFAERADKEGWPAARFLTALAEHEIAERARRRIERHLTEAHLPPGKTLDGF 80 
146276369   1 MSTSEPIDEARLGLLLGDLRLPTIKHIWPAFAERADKEGWPAARFLTALAEHEIAERARRRIERHLTEAHLPPGKTLDGF 80 
167621681  81 DFDAVPTVSKAQVMALAAGDSWLDNGANLLMFGPPGGGKSHLAAALGLALVENGWRVFFTRTTDLVQRLQTARRDLQLEA 160
27380110   93 DFEAVPMISKAQMTALAAGDGWLGKGANLLLFGPPGGGKSHLAAAIGLALIENGWRVLFTRTTDLVQKLQVARRELNLEG 172
27378637   93 DFEAVPMISKAQMTALAAGDGWLGKGANLLLFGPPGGGKSHLAAAIGLALIENGWRVLFTRTTDLVQKLQVARRELNLEG 172
27377107   93 DFEAVPMISKAQMTALAAGDGWLGKGANLLLFGPPGGGKSHLAAAIGLALIENGWRVLFTRTTDLVQKLQVARRELNLEG 172
27377010   93 DFEAVPMISKAQMTALAAGDGWLGKGANLLLFGPPGGGKSHLAAAIGLALIENGWRVLFTRTTDLVQKLQVARRELNLEG 172
27376818   93 DFEAVPMISKAQMTALAAGDGWLGKGANLLLFGPPGGGKSHLAAAIGLALIENGWRVLFTRTTDLVQKLQVARRELNLEG 172
227818790  82 AFDAVPMVSKAQVMAIAAGDSWLAKGANILLFGPPGGGKSHLAAAIGLALIENGWRVLFTRTTDLVQKLQVARRELQLES 161
146279516  81 DFEAVPMLSKAQIMAMVAGDSWLEKGDNLLVFGPPGGGKSHLAAAIGLGLIENGWRVFFTRTTDLVQRLQVARRELALEQ 160
146276989  81 DFEAVPMLSKAQIMAMVAGDSWLEKGDNLLVFGPPGGGKSHLAAAIGLGLIENGWRVFFTRTTDLVQRLQVARRELALEQ 160
146276369  81 DFEAVPMLSKAQIMAMVAGDSWLEKGDNLLVFGPPGGGKSHLAAAIGLGLIENGWRVFFTRTTDLVQRLQVARRELALEQ 160
167621681 161 AIAKLDKYHLLILDDLAYVTKDQAETSVLFELISARYERRSLLITANQPFGEWGRIFPDQAMTLAAVDRLVHHATIFEMN 240
27380110  173 AINRLDRFDLVILDDLAYVTKDQAETSVLFELISARYERRSLLITANQPFGEWNKVFPDPAMTLAAIDRLVHHATIVEMN 252
27378637  173 AINRLDRFDLVILDDLAYVTKDQAETSVLFELISARYERRSLLITANQPFGEWNKVFPDPAMTLAAIDRLVHHATIVEMN 252
27377107  173 AINRLDRFDLVILDDLAYVTKDQAETSVLFELISARYERRSLLITANQPFGEWNKVFPDPAMTLAAIDRLVHHATIVEMN 252
27377010  173 AINRLDRFDLVILDDLAYVTKDQAETSVLFELISARYERRSLLITANQPFGEWNKVFPDPAMTLAAIDRLVHHATIVEMN 252
27376818  173 AINRLDRFDLVILDDLAYVTKDQAETSVLFELISARYERRSLLITANQPFGEWNKVFPDPAMTLAAIDRLVHHATIVEMN 252
227818790 162 AIAKLDKFDLLILDDLAYVTKDQAETSVLFELISARYERRSIMITANQPFGEWNRVFPDPAMTLAAVDRLVHHATIFEMN 241
146279516 161 AIAKLDKYHLLILDDLAYVTKDQAETSALFELISARYERRSILITANQPFGEWNRIFPDPAMTLAAVDRLVHHATILELN 240
146276989 161 AIAKLDKYHLLILDDLAYVTKDQAETSALFELISARYERRSILITANQPFGEWNRIFPDPAMTLAAVDRLVHHATILELN 240
146276369 161 AIAKLDKYHLLILDDLAYVTKDQAETSALFELISARYERRSILITANQPFGEWNRIFPDPAMTLAAVDRLVHHATILELN 240
167621681 241 VESYRRRTAIERKRGPGRPLIRATIKTSA 269
27380110  253 VESYRRRTALERKRGPGRPPEHATQKTLA 281
27378637  253 VESYRRRTALERKRGPGRPPEHATQKTLA 281
27377107  253 VESYRRRTALERKRGPGRPPEHATQKTLA 281
27377010  253 VESYRRRTALERKRGPGRPPEHATQKTLA 281
27376818  253 VESYRRRTALERKRGPGRPPEHATQKTLA 281
227818790 242 VESYRRRSAMEAKRHRGRPAAFATTKSAS 270
146279516 241 VESYRRRTALERKKGPGRPPTRATIKNTS 269
146276989 241 VESYRRRTALERKKGPGRPPTRATIKNTS 269
146276369 241 VESYRRRTALERKKGPGRPPTRATIKNTS 269
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap