Conserved Protein Domain Family
PRK08091

?
PRK08091: PRK08091 
ribulose-phosphate 3-epimerase; Validated
Statistics
?
PSSM-Id: 169215
View PSSM: PRK08091
Aligned: 4 rows
Threshold Bit Score: 393.088
Threshold Setting Gi: 170718244
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
113460206   1 MSKLSLIQQLKQQKLSVGILSANWLQLNEEVTTLLENQINVLHFDIADGQFSSLFTVGAIGIKYFPTHCFKDVHLMVRNQ 80 
148826586   3 AEKVRLISALKSQPISVGILASNWLKFSKTLNVLSQNQLRLLHFDIADGQFSPFFTVGSMAIQQFPNTFIKDVHLMVKDQ 82 
170718244   1 MSKLSLIQQLKQQKLSVGILSANWLQLNEEVTTLLEKQINVLHFDIADGQFSSLFTVGAIGIKYFPTHCFKDVHLMVRNQ 80 
15603145    1 MDKKQLIQQLKTQPISVGILASDWLKFADTLTTLSRHHLRLLHFDIGDGQFSPFFTVGALAVKQFPSPWLKDVHLMVNDP 80 
113460206  81 LEVAKAVVANGANLVTLQLEQYHDFALTIEWLAKQKTtyanqvypVLIGACLCPETPISELEPYLDQIDVIQLLTLDPRN 160
148826586  83 FNVVKKCVAAGADIMTLQVENTVDLDNTLQWLKTQKT--------ILCGLAICPNTPLELLYPYLPDIDLIQILTLDPRT 154
170718244  81 LEVAKAVVANGANLVTLQLEQYHDFALTIEWLAKQKTtyanqvypVLIGACLCPETPISELEPYLDQIDVIQLLTLDPRN 160
15603145   81 FHVAKACADAGADIITLQVEQTDCLAETISYLREHYPd-------LLIGLTLCPDTEIDLLTPYLAQVDLIQILTLDPRT 153
113460206 161 GTKYPSELILDRVIQVEKRLGNRRVEKLINIDGSMTLELAKYFKQgtHQIDWLVSGSALFS-GELKTNLKVWKSSIM 236
148826586 155 GEKANLDQITERLIQLLNQLHDSGQEKLISIDGSMTFELASHLKK--YEIDWVVSGSALFSsDSFEKTLIEWKKMLS 229
170718244 161 GTKYPSELILDRVIQVEKRLGNRRVEKLINIDGSMTLELAKYFKQgtHQIDWIVSGSALFS-GELKTNLKVWKSSIM 236
15603145  154 GVKAETDAVIKRITRISNMLGEHRDQKLISVDGSMNLALASQLFP--LGIDWVVSGSALFSqADVDATLSEWKTHLC 228
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap