Conserved Protein Domain Family
PRK08045

?
PRK08045: PRK08045 
cystathionine gamma-synthase; Provisional
Statistics
?
PSSM-Id: 169194
View PSSM: PRK08045
Aligned: 71 rows
Threshold Bit Score: 764.823
Threshold Setting Gi: 85060141
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157147263   1 MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRALAELEGGTGAVLTNTGMSAI 80 
45439980   28 MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFIDFNQPRTHDYSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSAL 107
162421237   1 MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFIDFNQPRTHDYSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSAL 80 
145601034   1 MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFIDFNQPRTHDYSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSAL 80 
51594463    1 MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFIDFNQPRTHDYSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSAI 80 
153947307   1 MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFIDFNQPRTHDYSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSAI 80 
170026302  28 MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFIDFNQPRTHDYSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSAL 107
186893452  28 MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFIDFNQPRTHDYSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSAI 107
253991716   5 MTRKQATIAVRSGLNHDEQYGCVVPPIYLSSTYNFTDFNQPRTHDYSRRSNPGRDMVQRALTELEGGVGAVMTSSGMSAI 84 
123440511   1 MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFIDFNQPRAHDYSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSAI 80 
157147263  81 LLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVLFVDQGDEQALKAALAEKPKLVLVESPSNPLLRVVDIAKIC 160
45439980  108 HLVCTTFLQPGDLLVAPHDCYGGSYRLFDSLSKRGAYRVLFVDQGDEAALNCALAEKPKLVLIETPSNPLLRVVDIAAIC 187
162421237  81 HLVCTTFLQPGDLLVAPHDCYGGSYRLFDSLSKRGAYRVLFVDQGDEAALNCALEEKPKLVLIETPSNPLLRVVDIAAIC 160
145601034  81 HLVCTTFLQPGDLLVAPHDCYGGSYRLFDSLSKRGAYRVLFVDQGDEAALNCALAEKPKLVLIETPSNPLLRVVDIAAIC 160
51594463   81 HLVCTTFLQPGDLLVAPHDCYGGSYRLFDSLSKRGAYRVLFVDQGDEAALNRALAEKPKLVLIETPSNPLLRVVDIAAIC 160
153947307  81 HLVCTTFLQPGDLLVAPHDCYGGSYRLFDSLSKRGAYRVLFVDQGDEAALNRALAEKPKLVLIETPSNPLLRVVDIAAIC 160
170026302 108 HLVCTTFLQPGDLLVAPHDCYGGSYRLFDSLSKRGAYRVLFVDQGDEAALNRALAEKPKLVLIETPSNPLLRVVDIAAIC 187
186893452 108 HLVCTTFLQPGDLLVAPHDCYGGSYRLFDSLSKRGAYRVLFVDQGDEAALNRALAEKPKLVLIETPSNPLLRVVDIAAIC 187
253991716  85 HLLCTVFLKPGDLLVAPHDCYGGSYRLFDSQSKRGAYEVAFVDQGDEQALKRVLSRKPKLVLIETPSNPLLRIVDIARIC 164
123440511  81 HLVCTTFLKPDDLLVAPHDCYGGSYRLFDSLSKRGAYRVLFVDQGDEVALSQALAKKPKLVLIETPSNPLLRVVDIAAIC 160
157147263 161 QLSREAGAVSVVDNTFLSPALQNPLALGADLVLHSCTKYLNGHSDVVAGVVIAKDPEIVTELAWWANNIGVTGGAFDSYL 240
45439980  188 QAARAAGALTVCDNTFLSPALQQPLSLGADLVVHSCTKYLNGHSDVVAGAVIAKDPELVVELAWWANNIGVTGAAFDSYL 267
162421237 161 QAARAAGALTVCDNTFLSPALQQPLSLGADLVVHSCTKYLNGHSDVVAGAVIAKDPELVVELAWWANNIGVTGAAFDSYL 240
145601034 161 QAARAAGALTVCDNTFLSPALQQPLSLGADLVVHSCTKYLNGHSDVVAGAVIAKDPELVVELAWWANNIGVTGAAFDSYL 240
51594463  161 QAARAAGALTVCDNTFLSPALQQPLSLGADLVVHSCTKYLNGHSDVVAGAVIAKDPELVVELAWWANNIGVTGAAFDSYL 240
153947307 161 QAARAAGALTVCDNTFLSPALQQPLSLGADLVVHSCTKYLNGHSDVVAGAVIAKDPELVVELAWWANNIGVTGAAFDSYL 240
170026302 188 QAARAAGALTVCDNTFLSPALQQPLSLGADLVVHSCTKYLNGHSDVVAGAVIAKDPELVVELAWWANNIGVTGAAFDSYL 267
186893452 188 QAARAAGALTVCDNTFLSPALQQPLSLGADLVVHSCTKYLNGHSDVVAGAVIAKDPELVVELAWWANNIGVTGAAFDSYL 267
253991716 165 QLSHAVGATVIADNTFLSPVLQKPLELGADLVVHSCTKYLNGHSDVIAGAIIAKDEDIATELAWWANNIGVTGAAFDSYL 244
123440511 161 KDAHAVGALTVCDNTFLSPALQQPLALGADLVVHSCTKYLNGHSDVVAGAVIAKDPELAVELAWWANNIGVTGAAFDSYL 240
157147263 241 LLRGLRTLVPRMDVAQRNAQAIVDYLQTQPLVKKLYHPSLPDNQGHEIAARQQKGFGAMLSFELDGDEQTLRRFLGGLSL 320
45439980  268 LLRGLRTLSPRMAQQQRNADDIVRYLQQQPLVKKLYHPSLPQHPGHEIACRQQSGFGAMLSFELDGDEQVMRRFLSALEL 347
162421237 241 LLRGLRTLSPRMAQQQRNADDIVRYLQQQPLVKKLYHPSLPQHPGHEIACRQQSGFGAMLSFELDGDEQVMRRFLSALEL 320
145601034 241 LLRGLRTLSPRMAQQQRNADDIVRYLQQQPLVKKLYHPSLPQHPGHEIACRQQSGFGAMLSFELDGDEQVMRRFLSALEL 320
51594463  241 LLRGLRTLSPRMAQQQRNADDIVRYLQQQPLVKKLYHPSLPQHPGHEIACRQQSGFGAMLSFELDGDEQVMRRFLSALEL 320
153947307 241 LLRGLRTLSPRMAQQQRNADDIVRYLQQQPLVKKLYHPSLPQHPGHEIACRQQSGFGAMLSFELDGDEQVMRRFLSALEL 320
170026302 268 LLRGLRTLSPRMAQQQRNADDIVRYLQQQPLVKKLYHPSLPQHPGHEIACRQQSGFGAMLSFELDGDEQVMRRFLSALEL 347
186893452 268 LLRGLRTLSPRMAQQQRNADDIVRYLQQQPLVKKLYHPSLPQHPGHEIACRQQSGFGAMLSFELDGDEQVMRRFLSALEL 347
253991716 245 LLRGIRTLSPRVLLQQNNALEIVNYLQQQPLVKKLFYPSLKDHPGHEIACKQQSGFGAMISFELDGSEQAIRCFLSELKL 324
123440511 241 LLRGLRTLSPRMAQQQRNADDIVRYLQQQPLVKKLYHPSLLQHPGHEIACRQQSGFGAMLSFELDGDEQVLRRFLSALEL 320
157147263 321 FTLAESLGGVESLISHAATMTHAGMAPEARAAAGISETLLRISTGIEDGEDLIADLENGFRAANKG 386
45439980  348 FTLAESLGGVESLISHAATMTHAGMAAEARIAAGITDSLLRISVGIEDSEDLIADLDHAFQLAVTR 413
162421237 321 FTLAESLGGVESLISHAATMTHAGMAAEARIAAGITDSLLRISVGIEDSEDLIADLDHAFQLAVTR 386
145601034 321 FTLAESLGGVESLISHAATMTHAGMAAEARIAAGITDSLLRISVGIEDSEDLIADLDHAFQLAVTR 386
51594463  321 FTLAESLGGVESLISHAATMTHAGMAAEARIAAGITDSLLRISVGIEDSEDLIADLDHAFQLAVTR 386
153947307 321 FTLAESLGGVESLISHAATMTHAGMAAEARIAAGITDSLLRISVGIEDSEDLIADLDHAFQLAVTR 386
170026302 348 FTLAESLGGVESLISHAATMTHAGMAAEARIAAGITDSLLRISVGIEDSEDLIADLDHAFQLAVTR 413
186893452 348 FTLAESLGGVESLISHAATMTHAGMAAEARIAAGITDSLLRISVGIEDSEDLIADLDHAFQLAVTR 413
253991716 325 FTLAESLGGVETLISHTATMTHAGMSAQARAEAGITDSLLRVSVGIEDSQDLIADLENAFQAVVKE 390
123440511 321 FTLAESLGGVESLISHAATMTHAGMAPEARTAAGITDSLLRISVGIEDSEDLIADLDNAFRLARD- 385
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap