Conserved Protein Domain Family
PRK08044

?
PRK08044: PRK08044 
allantoinase AllB
Statistics
?
PSSM-Id: 169193
View PSSM: PRK08044
Aligned: 43 rows
Threshold Bit Score: 809.853
Threshold Setting Gi: 29377460
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
52079533    1 MNFDSIIKNGLVILENGEQEVEVGIKDGKIAAIGQDLGTSAKIIDAKGSIVSPGMIDAHVHITEPGGGYrdeWEGYDTGT 80 
238893473   1 MSFDLIIKNGTVILENESRVVDIAVNDGKIAAIGEHLGEAKQVMDATGLIVSPGMVDAHTHISEPGRTH---WEGYETGT 77 
224582360  18 MSFDLIIKNGTVILENEARVIDIAVQGGKIAAIGENLEEAKNVLDATGLMVSPGMVDAHTHISEPGRTH---WEGYETGT 94 
29142730    1 MSFDLIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLDATGLIVSPGMVDAHTHISEPGRTH---WEGYETGT 77 
16759498    1 MSFDLIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLDATGLIVSPGMVDAHTHISEPGRTH---WEGYETGT 77 
16763903    1 MSFDLIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLDATGLIVSPGMVDAHTHISEPGRTH---WEGYETGT 77 
198242835   1 MSFDLIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLDATGLIVSPGMVDAHTHISEPGRTH---WEGYETGT 77 
194446659   1 MSFDLIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLDATGLIVSPGMVDAHTHISEPGRTH---WEGYETGT 77 
62179132    1 MSFDLIIKNGTVILENEARVIDIAVQGGKIAAIGENLEEAKNVLDATGLIVSPGMVDAHTHISEPGRTH---WEGYETGT 77 
207856001   1 MSFDLIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLDATGLIVSPGMVDAHTHISEPGRTH---WEGYETGT 77 
52079533   81 RAAAKGGVTTFIEMPLNQVPATVDEESIQEKFKAGKGKLSVDVASYGGLVPFDLDGgIQELDSNGVVAYKCFLATCGDRS 160
238893473  78 RAAAKGGITTMIEMPLNQLPATVDRQTIELKFDAAKGKLTIDAAQLGGLVSYNLDR-LHELDEVGVVGFKCFVATCGDRG 156
224582360  95 RAAAKGGITTMIEMPLNQLPATVDRETIELKFDAAKGKLTIDAAQLGGLVSYNLDR-LHELDEVGVVGFKCFVATCGDRG 173
29142730   78 RAAAKGGITTMIEMPLNQLPATVDRETIELKFDAAKGKLTIDAAQLGGLVSYNLDR-LHELDEVGVVGFKCFVATCGDRG 156
16759498   78 RAAAKGGITTMIEMPLNQLPATVDRETIELKFDAAKGKLTIDAAQLGGLVSYNLDR-LHELDEVGVVGFKCFVATCGDRG 156
16763903   78 RAAAKGGITTMIEMPLNQLPATVDRETIELKFDAAKGKLTIDAAQLGGLVSYNLDR-LHELDEVGVVGFKCFVATCGDRG 156
198242835  78 RAAAKGGITTMIEMPLNQLPATVDRETIELKFDAAKGKLTIDAAQLGGLVSYNLDR-LHELDEVGVVGFKCFVATCGDRG 156
194446659  78 RAAAKGGITTMIEMPLNQLPATVDRETIELKFDAAKGKLTIDAAQLGGLVSYNLDR-LHELDEVGVVGFKCFVATCGDRG 156
62179132   78 RAAAKGGITTMIEMPLNQLPATVDRETIELKFDAAKGKLTIDAAQLGGLVSYNLDR-LHELDEVGVVGFKCFVATCGDRG 156
207856001  78 RAAAKGGITTMIEMPLNQLPATVDRETIELKFDAAKGKLTIDAAQLGGLVSYNLDR-LHELDEVGVVGFKCFVATCGDRG 156
52079533  161 IEGDFMNVDDYSLYEGMKQIAKTGKILSIHAENAAITDKLGEIASKNGETSLRAYVDSRPVFTEVEPIRKIILFAKETGC 240
238893473 157 IDNDFRDVNDWQFFKGIQKLAEMKQTVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAKVAGC 236
224582360 174 IDNDFRDVNDWQFYKGAQKLGEMDQTVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAKAAGC 253
29142730  157 IDNDFRDVNDWQFYKGAQKLGEMDQTVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAKAAGC 236
16759498  157 IDNDFRDVNDWQFYKGAQKLGEMDQTVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAKAAGC 236
16763903  157 IDNDFRDVNDWQFYKGAQKLGEMDQTVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAKAAGC 236
198242835 157 IDNDFRDVNDWQFYKGAQKLGEMDQTVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAKAAGC 236
194446659 157 IDNDFRDVNDWQFYKGAQKLGEMDQTVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAKAAGC 236
62179132  157 IDNDFRDVNDWQFYKGAQKLGEMDQTVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAKAAGC 236
207856001 157 IDNDFRDVNDWQFYKGAQKLGEMDQTVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAKAAGC 236
52079533  241 RVHIVHIACEEGVDEIVKAQQEGVDITCETCTHYLYFYKEELDHIGPVVKCSPPIREQSRLEGMWNRVLNGDISFVTSDH 320
238893473 237 RLHVCHVSSPEGVAEVTRARQEGQDVTCESCPHYFVLDTDQFAEIGTLAKCSPPIRDAENQKGMWEKLFNGEIDCLVSDH 316
224582360 254 RLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIRDQENQKGMWEKLFNGEIDCLVSDH 333
29142730  237 RLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIRDQENQKGMWEKLFNGEIDCLVSDH 316
16759498  237 RLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIRDQENQKGMWEKLFNGEIDCLVSDH 316
16763903  237 RLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIRDQENQKGMWEKLFNGEIDCLVSDH 316
198242835 237 RLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIRDQENQKGMWEKLFNGEIDCLVSDH 316
194446659 237 RLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIRDQENQKGMWEKLFNGEIDCLVSDH 316
62179132  237 RLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIRDQENQKGMWEKLFNGEIDCLVSDH 316
207856001 237 RLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIRDQENQKGMWEKLFNGEIDCLVSDH 316
52079533  321 SPCTPDLKAtDNAFEAWGGIAGLQNNVDVLFDEGVQKRNMPLSKFAAIIATNPAKRFNLASKGSIAVGKDADFVFIKKDA 400
238893473 317 SPCPPEMKA-GNIMQAWGGIAGLQNCMDVMFDEAVQKRGMSLPQFARLMATNAADIFGLKHKGRIAPGKDADLVFIQPNS 395
224582360 334 SPCPPEMKA-GNIMQAWGGIAGLQNCMDVMFDEAVQKRGMSLPMFGKLMATNAADIFGLKHKGRIAPGKDADLVFIQPDS 412
29142730  317 SPCPPEMKA-GNIMQAWGGIAGLQNCMDVMFDEAVQKRGMSLPMFGKLMATNAADIFGLKHKGRIAPGKDADLVFIQPDS 395
16759498  317 SPCPPEMKA-GNIMQAWGGIAGLQNCMDVMFDEAVQKRGMSLPMFGKLMATNAADIFGLKHKGRIAPGKDADLVFIQPDS 395
16763903  317 SPCPPEMKA-GNIMQAWGGIAGLQNCMDVMFDEAVQKRGMSLPMFGKLMATNAADIFGLKHKGRIAPGKDADLVFIQPDS 395
198242835 317 SPCPPEMKA-GNIMQAWGGIAGLQNCMDVMFDEAVQKRGMSLPMFGKLMATNAADIFGLKHKGRIAPGKDADLVFIQPDS 395
194446659 317 SPCPPEMKA-GNIMQAWGGIAGLQNCMDVMFDEAVQKRGMSLPMFGKLMATNAADIFGLKHKGRIAPGKDADLVFIQPDS 395
62179132  317 SPCPPEMKA-GNIMQAWGGIAGLQNCMDVMFDEAVQKRGMSLPMFGKLMATNAADIFGLKHKGRIAPGKDADLVFIQPDS 395
207856001 317 SPCPPEMKA-GNIMQAWGGIAGLQNCMDVMFDEAVQKRGMSLPMFGKLMATNAADIFGLKHKGRIAPGKDADLVFIQPDS 395
52079533  401 PYELKAEDLAYRHKISPYIGRKIGAQVVKTILRGVEIYDKEKGISNEKVGRFIP 454
238893473 396 SYVLRAEDLEYRHKVSPYVGRKIGARIAKTILRGEVIYDIEQGFPREPKGKFIL 449
224582360 413 SYVLKNEDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEHGFPVPPKGQFIL 466
29142730  396 SYVLKNEDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEHGFPVPPKGQFIL 449
16759498  396 SYVLKNEDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEHGFPVPPKGQFIL 449
16763903  396 SYVLKNEDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEHGFPVPPKGQFIL 449
198242835 396 SYVLKNEDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEHGFPVPPKGQFIL 449
194446659 396 SYVLKNEDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEHGFPVPPKGQFIL 449
62179132  396 SYVLKNEDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEHGFPVPPKGQFIL 449
207856001 396 SYVLKNEDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEHGFPVPPKGQFIL 449
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap