Conserved Protein Domain Family
PRK08005

?
PRK08005: PRK08005 
ribulose-phosphate 3 epimerase family protein
Statistics
?
PSSM-Id: 169179
View PSSM: PRK08005
Aligned: 22 rows
Threshold Bit Score: 407.501
Threshold Setting Gi: 194451933
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218561473   1 MILHPSLASANPLHYGRELTALDNLDFGSLHLDIEDSSFINNITFGMKTVQAVARQTPHPLSFHFMLARPQRWFNALAEI 80 
218707961   1 MILHPSLASANPLHYGRELTALDNLDFGSLHLDIEDSSFINNITFGMKTVQAVARQTPHPLSFHFMLARPQRWFNALAEI 80 
253775084   1 MILHPSLASANPLHYGRELTALDNLDFGSLHLDIEDSSFINNITFGMKTVQAVARQTPHPLSFHFMLARPQRWFNALAEI 80 
194451933   1 MILHPSLASADPLRYAEALTALHDAPLGSLHLDIEDTSFINNITFGMKTIQAVAQHTRHPLSLHLMVSSPQRWLPWLAAI 80 
254164220   1 MILHPSLASANPLHYGRELTALDNLDFGSLHLDIEDSSFINNITFGMKTVQAVARQTPHPLSFHFMLARPQRWFNALAEI 80 
224583890   5 MILHPSLASADPLRYAEALTALHDAPLGSLHLDIEDTSFINNITFGMKTIQAVAQHTRHPLSLHLMVSSPQRWLPWLAAI 84 
170083735   1 MILHPSLASANPLHYGRELTALDNLDFGSLHLDIEDSSFINNITFGMKTVQAVARQTPHPLSFHFMLARPQRWFNALAEI 80 
16132122    1 MILHPSLASANPLHYGRELTALDNLDFGSLHLDIEDSSFINNITFGMKTVQAVARQTPHPLSFHFMLARPQRWFNALAEI 80 
194442867   1 MILHPSLASADPLRYAEALTALHDAPLGSLHLDIEDTSFINNITFGMKTIQAVAQHTRHPLSFHLMVSSPQRWLPWLAAI 80 
62180183    1 MILHPSLASADPLRYAEALTALHDAPLGSLHLDIEDTSFINNITFGMKTIQAVAQHTRHPLSLHLMVSSPQRWLPWLAAI 80 
218561473  81 RPAWIFVHAETLDYPSETLTEIRHTGARAGLVFNPATPIDAWRYLASELDGVMVMTSEPDGQGQRFIPSMCEKIQKVRTA 160
218707961  81 RPAWIFVHAETLDYPSETLTEIRHTGARAGLVFNPATPIDAWRYLASELDGVMVMTSEPDGQGQRFIPSMCEKIQKVRTA 160
253775084  81 RPAWIFVHAETLDYPSETLTEIRHTGARAGLVFNPATPIDAWRYLASELDGVMVMTSEPDGQGQRFIPSMCEKIQKVRTA 160
194451933  81 RPGWIFIHAESVQNPSEILADIRAIGAKAGLALNPATPLLSYRYLALQLDALMIMTSEPDGRGQQFIATMCEKVSQSREH 160
254164220  81 RPAWIFVHAETLDYPSETLTEIRHTGARAGLVFNPATPIDAWRYLASELDGVMVMTSEPDGQGQRFIPSMCEKIQKVRTA 160
224583890  85 RPGWIFIHAESVQNPSEILADIRAIGAKAGLALNPATPLLSYRYLALQLDALMIMTSEPDGRGQQFIATMCEKVSQSREH 164
170083735  81 RPAWIFVHAETLDYPSETLTEIRHTGARAGLVFNPATPIDAWRYLASELDGVMVMTSEPDGQGQRFIPSMCEKIQKVRTA 160
16132122   81 RPAWIFVHAETLDYPSETLTEIRHTGARAGLVFNPATPIDAWRYLASELDGVMVMTSEPDGQGQRFIPSMCEKIQKVRTA 160
194442867  81 RPGWIFIHAESVQNPPEILADIRAIGAKAGLALNPATPLLPYRYLALQLDALMIMTSEPDGRGQQFIAAMCEKVNQSREH 160
62180183   81 RPGWIFIHAESVQNPSEILADIRAIGAKAGLALNPATPLLSYRYLALQLDALMIMTSEPDGRGQQFIATMCEKVSQSRDH 160
218561473 161 FPQTECWADGGITLAAAQQLAAAGAQHMVIGRALFSSSDYRATLAQFATL 210
218707961 161 FPQTECWADGGITLAAAQQLAAAGAQHMVIGRALFSSSDYRATLAQFATL 210
253775084 161 FPQTECWADGGITLAAAQQLAAAGAQHMVIGRALFSSSDYRATLAQFATL 210
194451933 161 FPAAECWADGGITLRAARLLAAAGAQHLVIGRALFTTANYNVTLSQFTAL 210
254164220 161 FPQTECWADGGITLAAAQQLAAAGAQHMVIGRALFSSSDYRATLAQFATL 210
224583890 165 FPAAECWADGGITLRAARLLAAAGAQHLVIGRALFTTANYDVTLSQFTAL 214
170083735 161 FPQTECWADGGITLAAAQQLAAAGAQHMVIGRALFSSSDYRATLAQFATL 210
16132122  161 FPQTECWADGGITLAAAQQLAAAGAQHMVIGRALFSSSDYRATLAQFATL 210
194442867 161 FPAAECWADGGITLRAARLLAAAGAQHLVIGRALFTTANYNVTLSQFTAL 210
62180183  161 FPAAECWADGGITLRAARLLAAAGAQHLVIGRALFTTANYDVTLSQFTAL 210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap