Conserved Protein Domain Family
PRK07912

?
PRK07912: PRK07912 
salicylate synthase
Statistics
?
PSSM-Id: 169151
View PSSM: PRK07912
Aligned: 16 rows
Threshold Bit Score: 707.326
Threshold Setting Gi: 54022586
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
183983686   1 MEVSV----EASAVSTAEPSIPMPADIDPADLAAELAVVLCEAVrpeGTQYLLYERDGQWVLASGVQAMVELDSDEVRVI 76 
118466860   2 TEVSV----ETTSAGSESPSIPLPVHIDPADLAAELAVVLSERA---GEEYLLYERGGEWVLATGVRAMIELDSDELRVI 74 
41408303    2 TEVSV----ETTSAGSESPSIPLPVHIDPADLAAELAVVLSERA---GEEYLLYERGGEWVLATGVRAMIELDSDELRVI 74 
118473231   2 TQAGI----ETASENAEVTGLSLPPGADPVDFVAELARALPERD---GEEYVVYERDRQWTLAAGVRAVIELDSDEIRVI 74 
148662218   2 SELSV----ATGAVSTASSSIPMPAGVNPADLAAELAAVVTESV---DEDYLLYECDGQWVLAAGVQAMVELDSDELRVI 74 
253798537   2 SELSV----ATGAVSTASSSIPMPAGVNPADLAAELAAVVTESV---DEDYLLYECDGQWVLAAGVQAMVELDSDELRVI 74 
118618919   2 VEVSV----EASAVSTAEPSIPMPADIDPADLAAELAVVLCDAVrpeGTQYLLYERDGQWVLASGVQAMVELDSDEVRVM 77 
121638265   2 SELSV----ATGAVSTASSSIPMPAGVNPADLAAELAAVVTESV---DEDYLLYECDGQWVLAAGVQAMVELDSDELRVI 74 
224990759   2 SELSV----ATGAVSTASSSIPMPAGVNPADLAAELAAVVTESV---DEDYLLYECDGQWVLAAGVQAMVELDSDELRVI 74 
169629331   2 SKMSAvvdpDTGARTWVSVQEGLPDGFAPADLAGALAQEIPERH---GDEYLIYERDGEWVLAIGARASVELDSDGLRIV 78 
183983686  77 RDGVTQRQQWSGRPGEVLGEAIDRLLLETDQVFGWVAFEFGLYRYGLQARLAPGTPLARVFWPRTRIVVTRDDVSLFGAE 156
118466860  75 RDGVTQRQHWSGRPGPVLGEAIDRLLLETDQLFGWIAFEFGVYRYGLQQRLAPGTALARVFWPNGRVVVTREAIQLFGTS 154
41408303   75 RDGVTQRQHWSGRPGPVLGEAIDRLLLETDQLFGWIAFEFGVYRYGLQQRLAPGTALARVFWPNGRIVVTREAIQLFGTS 154
118473231  75 SDDVVQSQPWTGRPGAALGEAVDRLLLETEQLFGWVAFEFGTYRFGLQEHLKPGTPLARVLAPRTRIVVADGRVELIGAD 154
148662218  75 RDGVTRRQQWSGRPGAALGEAVDRLLLETDQAFGWVAFEFGVHRYGLQQRLAPHTPLARVFSPRTRIMVSEKEIRLFDAG 154
253798537  75 RDGVTRRQQWSGRPGAALGEAVDRLLLETDQAFGWVAFEFGVHRYGLQQRLAPHTPLARVFSPRTRIMVSEKEIRLFDAG 154
118618919  78 RDGVTQRQQWSGRPGEVLGEAIDRLLLETDQVFGWVAFEFGLYRYGLQARLAPGTPLARVFWPRTRIVVTRDDVSLFGAE 157
121638265  75 RDGVTRRQQWSGRPGAALGEAVDRLLLETDQAFGWVAFEFGVHRYGLQQRLAPHTPLARVFSPRTRIMVSEKEIRLFDAG 154
224990759  75 RDGVTRRQQWSGRPGAALGEAVDRLLLETDQAFGWVAFEFGVHRYGLQQRLAPHTPLARVFSPRTRIMVSEKEIRLFDAG 154
169629331  79 RDGTIEKRDWSGHPGAALEQAVNEISDGTHRVFGWVAFEFGTYRFNLQHRLAPGTPLARVFAPRAEVVITADGVSVSDES 158
183983686 157 PHEREAVLRLLRDGLPTVPRSRTIDLSADPSGYRDRVAVAVREIASGAYHKVILSRCVEVPFRLDFPSTYRRGRERNTPV 236
118466860 155 TGRRDDVLGVLGDGVPGLRDASAVDVVTDPSNYRDRVASAVAEIAAGRYHKVILSRCLQVPFALDFPSTYRLARRHNTPV 234
41408303  155 TGRRDDVLGVLGDGVPGLRDASAVDVVTDPSNYRDRVASAVAEIAAGRYHKVILSRCLQVPFAVDFPSTYRLARRHNTPV 234
118473231 155 ERQVEAVRRLLAGTIGPAPVSTAVDVRADGSRYRDRVATAIGEITGGRYQKVILSRRLELPFAVDFPATYRVGRRNNTPA 234
148662218 155 IRHREAIDRLLATGVREVPQSRSVDVSDDPSGFRRRVAVAVDEIAAGRYHKVILSRCVEVPFAIDFPLTYRLGRRHNTPV 234
253798537 155 IRHREAIDRLLATGVREVPQSRSVDVSDDPSGFRRRVAVAVDEIAAGRYHKVILSRCVEVPFAIDFPLTYRLGRRHNTPV 234
118618919 158 RHEREAVLRLLRDGLPTVPRSRTIDLSADPSGYRDRVAVAVREIASGAYHKVILSRCVEVPFRLDFPSTYRRGRERNTPV 237
121638265 155 IRHREAIDRLLATGVREVPQSRSVDVSDDPSGFRRRVAVAVDEIAAGRYHKVILSRCVEVPFAIDFPLTYRLGRRHNTPV 234
224990759 155 IRHREAIDRLLATGVREVPQSRSVDVSDDPSGFRRRVAVAVDEIAAGRYHKVILSRCVEVPFAIDFPLTYRLGRRHNTPV 234
169629331 159 --YVEDISRLIEQGVPAIPAPASIDLAPDPSDYRGRVGIATAEIRSGLYHKVILSRRVEVPFAMDFPSTYRLGRHNNTPV 236
183983686 237 RSFLLRLGGIRALGFSPELVTAVSPSGVVVTEPLAGTRALGRGAAHDRLARGDLESNAKEIVEHAISVRTSLHEITEVAE 316
118466860 235 RSFLLRLGGIRAVGYSPELVAAVRHDGVVVTEPLAGTRAFGRGALHDRQARDDLESNSKEIVEHAISVRSSLQEMAEIAE 314
41408303  235 RSFLLRLGGIRAVGYSPELVAAVRHDGVVVTEPLAGTRAFGRGALHDRQARDDLESNSKEIVEHAISVRSSLQEMAEIAE 314
118473231 235 RSFLLRLSGIRALGFSPELVAAVHADGTVITEPLAGTRAFGRGADDDRAAREDLVSNPKEIVEHAISVKTSISEIEEVAE 314
148662218 235 RSFLLQLGGIRALGYSPELVTAVRADGVVITEPLAGTRALGRGPAIDRLARDDLESNSKEIVEHAISVRSSLEEITDIAE 314
253798537 235 RSFLLQLGGIRALGYSPELVTAVRADGVVITEPLAGTRALGRGPAIDRLARDDLESNSKEIVEHAISVRSSLEEITDIAE 314
118618919 238 RSFLLRLGGIRALGFSPELVTAVSPSGVVVTEPLAGTRALGRGAAHDRLARGDLESNAKEIVEHAISVRTSLHEITEVAE 317
121638265 235 RSFLLQLGGIRALGYSPELVTAVRADGVVITEPLAGTRALGRGPAIDRLARDDLESNSKEIVEHAISVRSSLEEITDIAE 314
224990759 235 RSFLLQLGGIRALGYSPELVTAVRADGVVITEPLAGTRALGRGPAIDRLARDDLESNSKEIVEHAISVRSSLEEITDIAE 314
169629331 237 RSFLLRLGGIRALGYSPELVTAVEADGTVVTQPLAGTRAFGRGEDADRVARDDLESNAKEIVEHAISVRSSLAEIAEVVD 316
183983686 317 PGTAAVIDFMSVRERGSVQHLGSTISARLDAASDRMNALEALFPAVTASGIPKADGVDAILRLDEGPRGLYSGAVVMLSA 396
118466860 315 PGTAVVTDFMTVRERGSVQHLGSTVSGRLGTSNDRMDALEALFPAVTASGIPKAGGVEAILRLDEGPRGLYSGAVVMVSA 394
41408303  315 PGTAVVTDFMTVRERGSVQHLGSTVSGRLGTSNDRMDALEALFPAVTASGIPKAGGVEAILRLDEGPRGLYSGAVVMVSA 394
118473231 315 AGTAVVLDFMTVRERGSVQHLGSTVGGRLKGSMDRMHALEALFPAVTASGIPKAESMDAILRLDEAPRGLYSGAVVTFSA 394
148662218 315 PGSAAVIDFMTVRERGSVQHLGSTIRARLDPSSDRMAALEALFPAVTASGIPKAAGVEAIFRLDECPRGLYSGAVVMLSA 394
253798537 315 PGSAAVIDFMTVRERGSVQHLGSTIRARLDPSSDRMAALEALFPAVTASGIPKAAGVEAIFRLDECPRGLYSGAVVMLSA 394
118618919 318 PGTAAVIDFMSVRERGSVQHLGSTISARLDAASDRMNALEALFPAVTASGIPKADGVDAILRLDEGPRGLYSGAVVMLSA 397
121638265 315 PGSAAVIDFMTVRERGSVQHLGSTIRARLDPSSDRMAALEALFPAVTASGIPKAAGVEAIFRLDECPRGLYSGAVVMLSA 394
224990759 315 PGSAAVIDFMTVRERGSVQHLGSTIRARLDPSSDRMAALEALFPAVTASGIPKAAGVEAIFRLDECPRGLYSGAVVMLSA 394
169629331 317 PSSTKVTDFMTVRERGSVQHLGSTVSGELSAGMTRMDALEALFPAVTASGIPKAEGVDAILRLDDHPRGLYSGAVVMLSP 396
183983686 397 DGGLDAALTLRAAYERDGRTWLRAGAGIIEASQPEREFEETCEKLSTLAPYLVERQ 452
118466860 395 DGALDAALTLRAAYEHDGKTWLRAGAGIIEESTPEREFEETCEKLSTLAPYLIARQ 450
41408303  395 DGALDAALTLRAAYEHDGKTWLRAGAGIIEESTPEREFEETCEKLSTLAPYLIARQ 450
118473231 395 DGAMDAALTLRSAYEAHGATWLRAGAGIIAESTPEREFEETCEKLTTLAPHLVPRV 450
148662218 395 DGGLDAALTLRAAYQVGGRTWLRAGAGIIEESEPEREFEETCEKLSTLTPYLVARQ 450
253798537 395 DGGLDAALTLRAAYQVGGRTWLRAGAGIIEESEPEREFEETCEKLSTLTPYLVARQ 450
118618919 398 DGGLDAALTLRAAYERDGRTWLRAGAGIIEASQPEREFEETCEKLFTLAPYLVERQ 453
121638265 395 DGGLDAALTLRAAYQVGGRTWLRAGAGIIEESEPEREFEETCEKLSTLTPYLVARQ 450
224990759 395 DGGLDAALTLRAAYQVGGRTWLRAGAGIIEESEPEREFEETCEKLSTLTPYLVARQ 450
169629331 397 NGGLDAALTLRSAYEQDGHTWLRAGAGIIEASTPEREFEETCEKLGSIAPYVIKRE 452
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap