Conserved Protein Domain Family
PRK07874

?
PRK07874: PRK07874 
ATP synthase F0 subunit C
Statistics
?
PSSM-Id: 169138
View PSSM: PRK07874
Aligned: 13 rows
Threshold Bit Score: 99.485
Threshold Setting Gi: 25027866
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
226360601  1 MSLAYLAQEAVETTttaKGFGAIGYGLAAIGPGIGVGIVVGKAIEGMVRQPEMAGQVRTTMFLGIAFTEALALIGLVAGF 80 
38233641   1 MNEVILAASDTAVS---GSIATVGYGIATIGPGLGIGILVGKALEGMARQPEMAGQLRTTMFLGIAFVEALALIGLVAGF 77 
19552430   1 MNEIILAQDATESTi--TGLGAVGYGIATIGPGLGIGILVGKALEGMARQPEMAGQLRTTMFLGIAFVEALALIGLVAGF 78 
62390095   1 MNEIILAQDATESTi--TGLGAVGYGIATIGPGLGIGILVGKALEGMARQPEMAGQLRTTMFLGIAFVEALALIGLVAGF 78 
145295346  1 MNEIILAQDATESTi--TGLGAVGYGIATIGPGLGIGILVGKALEGMARQPEMAGQLRTTMFLGIAFVEALALIGLVAGF 78 
300858262  1 MNEAILAASDTAVS---GSIATVGYGLATIGPGLGIGILVGKALEGMARQPEMAGQLRTTMFLGIAFVEALALIGLVAGF 77 
68536425   1 MNDIFLIAQDTTTKf--QGFGTIGYGLAAIGSAIGVGNVAGKTAEAMARQPEMAGQLRTTMFLGIAFAEALALIGFVAGF 78 
172040391  1 MNDILFLAQDTVTKf--EGFGTIGYGLAAIGSAIGVGNVAGKTAEAMARQPEMAGQLRTTMFLGIAFAEALALIGFVAGF 78 
25027866   1 MNEIILAQADTVAAv--ADYRAVGYGIATIGPGIGIGILVGKALEGMARQPEMAGQLRTTMFLGIAFVEALALIGLVAGF 78 
227832895  1 MNEIILAQAADESTl--KGLGAIGYGIATIGPGLGIGILVGKTVEGMARQPEMAGQLRTTMFLGIAFVEALALIGLVAGF 78 
54023027   1 MSLSYLAQEAANESt-lKGLGAVGYGLAAIGPGIGVGIVVGKAIEGIARQPELQGTIRTNMFLGIAFTEALALIGLVAGF 79 
111018478  1 MSLAYLAQEAVQETn-sTGFGAIGYGLAAIGPGIGVGIVVGKAIEGMVRQPEMAGQVRTTMFLGIAFTEALALIGLVAGF 79 
226307397  1 MSIAYLAQEVVETKs--RGYGAIGYGLAAIGPGIGVGIVVGKAIEGMVRQPEMAGQVRTTMFLGIAFTEALALIGLVAGF 78 
226360601 81 IF 82 
38233641  78 IL 79 
19552430  79 LF 80 
62390095  79 LF 80 
145295346 79 LF 80 
300858262 78 IL 79 
68536425  79 LF 80 
172040391 79 LF 80 
25027866  79 LF 80 
227832895 79 LF 80 
54023027  80 IF 81 
111018478 80 IF 81 
226307397 79 IF 80 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap