Conserved Protein Domain Family
PRK07786

?
PRK07786: PRK07786 
long-chain-fatty-acid--CoA ligase; Validated
Statistics
?
PSSM-Id: 169098
View PSSM: PRK07786
Aligned: 22 rows
Threshold Bit Score: 873.332
Threshold Setting Gi: 111020930
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
108797095   6 DASEPSHTEQPYLARRQNWTNQLARHALMQPGDTALRFMGRTTTWGELDDRVTKLAGALSRRGVGFGDRVLILMLNRTEF 85 
126432718   6 DASEPSHTEQPYLARRQNWTNQLARHALMQPGDTALRFMGRTTTWGELDDRVTKLAGALSRRGVGFGDRVLILMLNRTEF 85 
119866180   6 DASEPSHTEQPYLARRQNWTNQLARHALMQPGDTALRFMGRTTTWGELDDRVTKLAGALSRRGVGFGDRVLILMLNRTEF 85 
118470372   1 MTAEPSQIEQPYLARRQNWVNQLTRHAMMQPDKTALRFLGRTTTWRELDDRVTRLAGALNRRGVGFGDRVLILMLNRTEF 80 
145221309  29 TGLSGSATEQPNLARRRNWANQLSRHALMQPDTVALRFLGRSTTWGELDRRVTALAGALHERGVGFGDRVLILMLNRTEF 108
226304137   1 -MASTDAVSEAQRSRRTNWNNQIARHAQMIPDRTALRFLGDSITWSTLDARVEKLADALARRGVSFGDRVLILMLNRPEY 79 
54027564    1 MTTGAQALDEPIRSRRNHWNNQLATHALMRPDAVALRFKGVDTTWKQLHERSEKFADALARRGVGFGDRVLILALNYPEY 80 
226365581   1 MSSRSEPLTQPLQSRRNHWNNWVATHAQTKPDHPAFRHLGQSTSWRELHERSQALAAALSRRGVNFGDRVLLLTLNRTEF 80 
120401159  22 IQQPGFATEQPYLARRQNWTNQLARHALMQPDQPALRFLGNTTTWGELDRRVSALAGALHKRGVGFGDRVLILMLNRTEF 101
111023082   1 MSSRSELLEQPLQSRRNHWNNWVASHAEMKPDQAAFRFLGHSTTWRDLHDRSEALAGALSRRGVNFGDRVLLLTLNRTEF 80 
108797095  86 IESFLAVNKLGAIAVPVNFRMTPPEIAFLVSDCAARVVVTEAVLAPVATAVRDLDPTLETVIVAGGATDDGILGYDDLIA 165
126432718  86 IESFLAVNKLGAIAVPVNFRMTPPEIAFLVSDCAARVVVTEAVLAPVATAVRDLDPTLETVIVAGGATDDGILGYDDLIA 165
119866180  86 IESFLAVNKLGAIAVPVNFRMTPPEIAFLVSDCAARVVVTEAVLAPVATAVRDLDPTLETVIVAGGATDDGILGYDDLIA 165
118470372  81 VEAMLAANRLGAIAVPVNFRMTPPEIAYLVSDCEAHVVVTEPVLAGVATAVRDLDATLQTVIVAGGATEDGVLGYDDLIA 160
145221309 109 MESVLAVNKLGGIAVPVNFRMTPSEIAFLVSDCAAEVVITESVLENVATAVRDIDPKLATVIVAGGTSRDNVLDYDDVLA 188
226304137  80 LEIVLATNALGAIAVPVNFRLTPPEVAYLVNDSGSKVIVAEGPLAPLAGAARAVSEGIDISITVGAPAEGDSLNYEDLIS 159
54027564   81 IEAVFGINALGAIAVPVNFRLTPPEVAYIVSDSGAKAIVTDTMLQPLAAAVRADAPALETLVVIGGRSDEGVLGYDDALA 160
226365581  81 FEAVLAINALGAIAVPVNFRLTPPEVAFIARDSGARAVFTEPALAPLVSAVRQDVPDLGLAIVMGAETEADVLGYEDLVA 160
120401159 102 IEAVLATNKLGAIAVPVNFRMTPAEIAFLVSDCEAKAIITEAVLANVATAVRDIDPTLATVISAGGSGDD-VLDYDDVLA 180
111023082  81 FEAVLAINALGAIAVPVNFRLTPPEVAFIARDSGARAVFTEPALAPLVAAVRQDVPGLSLVVNIGADTEADVLGYEELVS 160
108797095 166 EPGEAPAPVDIPNDAPALIMYTSGTTGRPKGAVLTHVNIAGQAMTFLFTNGVDLNHDVGFIGVPLFHIAGI-GNTIVGLL 244
126432718 166 EPGEAPAPVDIPNDAPALIMYTSGTTGRPKGAVLTHVNIAGQAMTFLFTNGVDLNHDVGFIGVPLFHIAGI-GNTIVGLL 244
119866180 166 EPGEAPAPVDIPNDAPALIMYTSGTTGRPKGAVLTHVNIAGQAMTFLFTNGVDLNHDVGFIGVPLFHIAGI-GNTIVGLL 244
118470372 161 EEGEPPAPVDIPNDSPALIMYTSGTTGRPKGAVLTHTNLSAQAMMHLFTTGADLNSDVGFVGVPLFHIAGVaGSVLSGVT 240
145221309 189 STTAAPPLVDIPDDSPALIMYTSGTTGRPKGAVLTHNNLAGQAMTLLFTNGADINHDIGFIGVPFFHIAGV-GSIVSGMM 267
226304137 160 EAGEPHAFVDIPDDTPALIMYTSGTTGRPKGSVLSHSNLSSQALTCIRAFHLFNADSIGFCASPMFHIAAL-GSIAPSLQ 238
54027564  161 EDGAPHAPLDIPEDTPSLIMYTSGTTGSPKGAVLTHANMNAQALTCIRAMEI-TPESVGFCTSPLFHIAGL-GSLAPYFM 238
226365581 161 EDGPAFAPVDLPEDTPSLILYTSGTTGTPKGAVLSHSNMVGQSITCIRAMRYDRGDDVGFLASPVFHVAAL-GSVAPMLM 239
120401159 181 ENAPC-PVVDIPNDAPALIMYTSGTTGRPKGAVLTHTNLTGQVMTLLFTNGADINHDIGFIGVPFFHIAGV-GSSVSGLL 258
111023082 161 EDGPAHAPVDLPEDTPSLILYTSGTTGTPKGAVLSHSNMVGQSITCIRAMRYDRGDDIGFLASPVFHVAAL-GSVAPMLM 239
108797095 245 LGRPTVLYPLGAFDPGALLDVLAEEKVTGIFLVPAQWQAVCAAQRAKPRDLKLRVLSWGAAPASDTLLRDMAETFPGAQI 324
126432718 245 LGRPTVLYPLGAFDPGALLDVLAEEKVTGIFLVPAQWQAVCAAQRAKPRDLKLRVLSWGAAPASDTLLRDMAETFPGAQI 324
119866180 245 LGRPTVLYPLGAFDPGALLDVLAEEKVTGIFLVPAQWQAVCAAQRAKPRDLKLRVLSWGAAPASDTLLRDMAETFPGAQI 324
118470372 241 LGVPTVLYPLGAFDPDGLLDVLESEQVTGIFLVPAQWQAVCAAQRARPRNLKLRALSWGAAPASDTLLREMNEVFPDAQI 320
145221309 268 LGRPTVIYPLGAFDPNELLDVLEAEKVTGIFLVPAQWQAVCAAQKANPRNLKLRFLSWGAAPASDTLLRQMSETFPGAQI 347
226304137 239 LGTTTVIHPVGAFDPGQLLDILEAEKVTSLFLVPVQWQAVCAVQKAQPRALSLKNISWGAAPSSDTILRAMAETFPDAFN 318
54027564  239 LGAKTVLHPLGAFNPTEFLDAVEAEQATTAFCVPAQWQAICAEPTVKQRKLALKMLSWGAAPASDSVLRAMAECFPEAQN 318
226365581 240 LGATTVIHPLKAFDPTEMLDVWERERITTVFLVPVQWQAVCADPTAAGRDLALRVISWGAAPASDTVLRAMAATFPKALV 319
120401159 259 LGRPTVLYPVGAFDPNELLDVLEAEKVTGIFLVPAQWQAVCAAQKARPRDLKLRFLSWGAAPASDTLLREMAETFPGAQI 338
111023082 240 LGGTTVIHPLKAFNPTEMLDVWEQERITTVFLVPVQWQAVCADPTVRGRDLALRVISWGAAPASDTVLRAMADTFPRALI 319
108797095 325 LAAFGQTEMSPVTCMLLGEDALRKLGSVGKVIPTVAARIVDEDMNDVPIGQVGEIVYRAPTLMAGYWNNPKATAEAFEGG 404
126432718 325 LAAFGQTEMSPVTCMLLGEDALRKLGSVGKVIPTVAARIVDEDMNDVPIGQVGEIVYRAPTLMAGYWNNPKATAEAFEGG 404
119866180 325 LAAFGQTEMSPVTCMLLGEDALRKLGSVGKVIPTVAARIVDEDMNDVPIGQVGEIVYRAPTLMAGYWNNPKATAEAFEGG 404
118470372 321 FAAFGQTEMSPVTCMLLGDDAIRKLGSVGRVIPTVSARVVDDNMNDVPVGEVGEIVYRGPNLMVGYWNNPKATAEAFAGG 400
145221309 348 LAAFGQTEMSPVTCMLLGDDALRKLGSVGKVIPTVSARIVDEDMNDVPIGQVGEIVYRAPTLMTGYWNNPTATAEAFAGG 427
226304137 319 VAVFGQTEMSPITCVLDGEDAIRKLGSVGRVIPTISARVVDENMDDVAPGEIGEIVYRGPTMMSEYWNNPTATADAFHGG 398
54027564  319 VAVFGQTEMSPITCVLEGKDALRKLGSVGKPIPTIQVRIVDDEMNDVAPGEVGEIVYRGPTLMQGYWNKPEATADAFEGG 398
226365581 320 VAVFGQTEMSPITCVLDGDDAIRKLGSVGKPVPTIQTRIVDDEMNDVAPGTVGEIVYRGPTMMQGYWQNPAATADAFAGG 399
120401159 339 LAAFGQTEMSPVTCMLLGDDAIRKLGSVGKVIPTVSARIVDEDMNDVPVGQVGEIVYRAPTLMAGYWNNPKATAEAFAGG 418
111023082 320 VAVFGQTEMSPITCVLDGDDAIRKLGSVGKPIPTIQTRVVDDDMNDVAPGTVGEIVYRGPTMMLEYWQNPAATADAFAGG 399
108797095 405 WFHSGDLVRQDEEGYIWVVDRKKDMIISGGENIYCAEVENVLAAHPAIAEVAVIGRAHEKWGEVPVAVAAVRGAEDAakp 484
126432718 405 WFHSGDLVRQDEEGYIWVVDRKKDMIISGGENIYCAEVENVLAAHPAIAEVAVIGRAHEKWGEVPVAVAAVRGAEDAakp 484
119866180 405 WFHSGDLVRQDEEGYIWVVDRKKDMIISGGENIYCAEVENVLAAHPAIAEVAVIGRAHEKWGEVPVAVAAVRGAEDAakp 484
118470372 401 WFHSGDLVRQDEEGYVWVVDRKKDMIISGGENIYCAEVENVLAAHPAIMEVAVIGRPHEKWGEVPVAVVALNSATAEs-- 478
145221309 428 WFHSGDLVRQDEEGYIWVVDRKKDMIISGGENIYCAEVENVLASHPDIVEVAVIGRSHRKWGEVPVAVAVLRSSLNStgs 507
226304137 399 WFHSGDLVRVDDEGFVYVVDRKKDMIISGGENIYCAEVENVLYEHELIVEAAVVGRPDAKWGEVPVAIVAMAPGSAVd-- 476
54027564  399 WFHSGDLVRTDEEGFVWVVDRKKDMIISGGENIYCAEVENVLFSHPKIREAAVIGRSHDKWGEVPVAIVALNNPDDE--- 475
226365581 400 WFHSGDLVRQDEEGFVYVVDRKKDMIISGGENIYCAEVENVLFGHPRIREAAVVGRPHPKWTEVPVAIVALDDDGDD--- 476
120401159 419 WFHSGDLVRQDEEGYIWVVDRKKDMIISGGENIYCAEVENVLAAHPEIVEVAVIGRAHEKWGEVPVAVAVVRSSLEAtpg 498
111023082 400 WFHSGDLVRQDDEGFVYVVDRKKDMIISGGENIYCAEVENVLFGHPRIREAAVVGRPDPKWTEVPVAVVALDDEGSD--- 476
108797095 485 paLSLADLDEFLTERLARYKHPKALEIVDALPRNPAGKVLKTELRQRYAGPKPIDVGESSTAPTGSAA 552
126432718 485 paLSLADLDEFLTERLARYKHPKALEIVDALPRNPAGKVLKTELRQRYAGPKPIDAGESSTAPTGSAA 552
119866180 485 paLSLADLDEFLTERLARYKHPKALEIVDALPRNPAGKVLKTELRQRYAGPKPIDVGESSTAPTGSAA 552
118470372 479 --ISLGELDSFLTERLARYKHPKALEVVDALPRNPSGKVLKTELRERFGRATSLDGGESNSATTVSAG 544
145221309 508 grLELTDLEQFLGDRLARYKHPKAIEIVEALPRNPAGKVLKTELRVRFGSEESVDAGESATAATSSAA 575
226304137 477 --LTIEELSSFLNDRLARYKHPKDIVVVEALPRNASGKVVKGELREKVRAVDAVS------------- 529
54027564  476 --LTLDELEPFLNENLARYKHPKDLVVVAELPRNASGKVVKVQLRKDYSS------------------ 523
226365581 477 --LTVDELAAWLDDKLARYKHPKDIVVVDALPRNASGKVVKGELRKAHGAPDVAVV------------ 530
120401159 499 agIELADLEQFLTERLARYKHPKALEIVDALPRNPAGKVLKTELRIRYSAASFADAGESSTPPTISTA 566
111023082 477 --LTVEELAAWLDDKLARYKHPKDVVIVDALPRNASGKVVKGELRKAHGATGVAVV------------ 530
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap