Conserved Protein Domain Family
PRK07756

?
PRK07756: PRK07756 
NADH-quinone oxidoreductase subunit A
Statistics
?
PSSM-Id: 169084
View PSSM: PRK07756
Aligned: 27 rows
Threshold Bit Score: 194.961
Threshold Setting Gi: 226315030
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
226315030   1 MSDIYTNNYVIVAIFLILGVLLPVATVSfVGPLLRPKKPTREKQTTYESGNIPVGDSWVRFNVKYYIFALMFVIFDVETL 80 
42784470    1 MASVYENSYMIVLIFLLLGILLPVVALT-LGRMLRPSKPSAAKATTYESGIEPFHDANIRFHARYYIFALLFVIFDVETL 79 
225867277   1 MASVYENSYMIVLIFLLLGILLPVVALT-LGRMLRPNKPSAAKATTYESGIEPFHDANIRFHARYYIFALLFVIFDVETL 79 
56421891    1 MSNIYANSYLIIFVFLCLGVLLPIGALT-AGRWLRPHVPSDAKATTYESGNNPFHDSRVQFQVRYYLFALLFVIFDIETV 79 
212640518  11 SLNVYVNSYVVVFVFLCLGILLPIVALT-AGRFLRPHAPNAAKQTTYESGLDPFHDSRVQFNVRYYIFALLFVIFDVETV 89 
138896933   1 MSNIYANSYLIVFVFLCLGVLLPIGALT-IGRWLRPNVPDEAKATTYESGNIPFHDSRIQFQVRYYLFALLFVIFDVETV 79 
163942988   1 MASVYENSYMIVLIFLLLGILLPVVALT-LGKMLRPNKPSAAKATTYESGIEPFHDANIRFHARYYIFALLFVIFDVETL 79 
239828583   1 MWNVYVNNYVIVFVFLCIGILLPVGALT-IGRFLRPHVPSEAKQTTYESGNNPFHDSRVQFQVRYYMFALLFVIFDVETV 79 
261420761   1 MSNIYANSYLIIFVFLCLGVLLPIGALT-AGRWLRPHVPSDAKATTYESGNNPFHDSRVQFQVRYYLFALLFVIFDIETV 79 
297531556   1 MSNIYANSYLIIFVFLCLGVLLPIGALT-AGRWLRPHVPSDAKATTYESGNNPFHDSRVQFQVRYYLFALLFVIFDIETV 79 
226315030  81 FLYPWAVAYKELGLFALVEMVIFISLLVVGLIYAWRKKVLEWN 123
42784470   80 FLYPWAVAYDKLGLFALIEMFIFVVMLLVGLAYAWKKKVLQWL 122
225867277  80 FLYPWAVAYDNLGLFALIEMLIFVVMLLVGLAYAWKKKVLQWL 122
56421891   80 FLYPWAVVYDQLGLFALVEMIIFIVLLAIGLIYAWKKKVLRWM 122
212640518  90 FLYPWAVAFEKLGAFALIEMLIFVVMLLIGLVYAWKKKVLKWM 132
138896933  80 FLYPWAVVYDQLGLFALVEMIIFIVLLAIGLIYAWKKKVLRWM 122
163942988  80 FLYPWAVAYDKLGLFALIEMLIFVVMLLVGLAYAWKKKVLQWL 122
239828583  80 FLYPWAVAYNKLGLFALVEMIIFVLMLVLGLVYAWKKKVLQWM 122
261420761  80 FLYPWAVVYDQLGLFALVEMIIFIVLLAIGLIYAWKKKVLRWM 122
297531556  80 FLYPWAVVYDQLGLFALVEMIMFIVLLAIGLIYAWKKKVLRWM 122
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap