Conserved Protein Domain Family
PRK07709

?
PRK07709: PRK07709 
fructose-bisphosphate aldolase; Provisional
Statistics
?
PSSM-Id: 169068
View PSSM: PRK07709
Aligned: 26 rows
Threshold Bit Score: 565.835
Threshold Setting Gi: 163943023
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30265359    1 MPLVSMKEMLNKALEGKYAVGQFNMNNLEWTQAILAAAEEEKSPVILGVSEGAARHMTGFKTVVAMVKALIEEMNITVPV 80 
52140227    1 MPLVSMKEMLNKALEGKYAVGQFNMNNLEWTQAILAAAEEEKSPVILGVSEGAARHMTGFKTVVAMVKALIEEMNISVPV 80 
218900461   1 MPLVSMKEMLNKALEGKYAVGQFNMNNLEWTQAILAAAEEEKSPVILGVSEGAARHMTGFKTVVAMVKALIEEMNITVPV 80 
301056803   1 MPLVSMKEMLNKALEGKYAVGQFNMNNLEWTQAILAAAEEEKSPVILGVSEGAARHMTGFKTVVAMVKALIEEMNISVPV 80 
56421921    1 MPLVSMKEMLNEALRGKYAVGQFNINNLEWTQAILAAAEEEKSPVILGVSEGAARYMSGFKTVVNMVKGLMEDMNITVPV 80 
138896962   1 MPLVSMKEMLNEALRGKYAVGQFNINNLEWTQAILAAAEEEKSPVILGVSEGAARYMGGFKTVVNMVKGLMEDMNITVPV 80 
163943023   1 MPLVSMKEMLNTALEGKYAVGQFNMNNLEWTQAILAAAEEEKSPVILGVSEGAARHMTGFKTVVAMVKALIEEMNISVPV 80 
239828615   1 MPLVSMKEMLNKALKEKYAVGQFNINNLEWTQAILAAAEEEKSPVILGVSEGAARYMSGFKTVVNMVKGLMEDMNITVPV 80 
261420791   1 MPLVSMKEMLNEALRGKYAVGQFNINNLEWTQAILAAAEEEKSPVILGVSEGAARYMSGFKTVVNMVKGLMEDMNITVPV 80 
297531586   1 MPLVSMKEMLNEALRGKYAVGQFNINNLEWTQAILAAAEEEKSPVILGVSEGAARYMSGFKTVVNMVKGLMEDMNITVPV 80 
30265359   81 AIHLDHGSSFEKCKEAIDAGFTSVMIDASHHPFEENVETTKKVVEYAHARNVSVEAELGTVGGQEDDVIAEGVIYADPAE 160
52140227   81 AIHLDHGSSFEKCKEAIDAGFTSVMIDASHHPFEENVETTKKVVEYAHARNVSVEAELGTVGGQEDDVIAEGVIYADPAE 160
218900461  81 AIHLDHGSSFEKCKEAIDAGFTSVMIDASHHPFEENVETTKQVVEYAHARNVSVEAELGTVGGQEDDVIAEGVIYADPAE 160
301056803  81 AIHLDHGSSFEKCKEAIDAGFTSVMIDASHHPFEENVETTKKVVEYAHARNVSVEAELGTVGGQEDDVIAEGVIYADPAE 160
56421921   81 AIHLDHGSSFEKCKAAIDAGFTSVMIDASHHPFEENVRITSQVVEYAHARGVSVEAELGIVGGQEDDVVGEGIIYADPKE 160
138896962  81 AIHLDHGSSFEKCKAAIDAGFTSVMIDASHHPFEENVRITSQVVEYAHARGVSVEAELGIVGGQEDDVIGEGVIYADPKE 160
163943023  81 AIHLDHGSSFEKCKEAIDAGFTSVMIDASHHPFDENVETTKKVVEYAHARNVSVEAELGTVGGQEDDIIAEGVIYADPAE 160
239828615  81 AIHLDHGSSFEKCKEAIDAGFTSVMIDASHHPFEENVKITSQVVEYAHARGVSVEAELGTVGGQEDDVIGKDIIYADPKE 160
261420791  81 AIHLDHGSSFEKCKAAIDAGFTSVMIDASHHPFEENVRITSQVVEYAHARGVSVEAELGIVGGQEDDVVGEGIIYADPKE 160
297531586  81 AIHLDHGSSFEKCKAAIDAGFTSVMIDASHHPFEENVRITSQVVEYAHARGVSVEAELGIVGGQEDDVVGEGIIYADPKE 160
30265359  161 CKHLVEATGIDCLAPALGSVHGPYKGEPNLGFAEMEQVRDFTGVPLVLHGGTGIPTADIEKAISLGTSKINVNTENQIEF 240
52140227  161 CKHLVEATGIDCLAPALGSVHGPYKGEPNLGFAEMEQVRDFTGVPLVLHGGTGIPTADIEKAISLGTSKINVNTENQIEF 240
218900461 161 CKHLVEATGIDCLAPALGSVHGPYKGEPNLGFAEMEQVRDFTGVPLVLHGGTGIPTADIVKAISLGTSKINVNTENQIEF 240
301056803 161 CKHLVEATGIDCLAPALGSVHGPYKGEPNLGFAEMEQVRDFTGVPLVLHGGTGIPTADIEKAISLGTSKINVNTENQIEF 240
56421921  161 CEELVKRTGVDCLAPALGSVHGPYKGEPKLGFAEMEQIRDLTGVPLVLHGGTGIPTEQIQRAISLGTSKINVNTENQMAF 240
138896962 161 CEELVKRTGIDCLAPALGSVHGPYKGEPKLGFAEMEQIRDLTGIPLVLHGGTGIPTEQIQRAISLGTSKINVNTENQIAF 240
163943023 161 CKHLVEATGIDCLAPALGSVHGPYKGEPNLGFAEMEQVRDFTGVPLVLHGGTGIPTADIVKAISLGTSKINVNTENQIEF 240
239828615 161 CEELVKRTGIDCLAPALGSVHGPYKGEPKLGFAEMEQIRDLTGIPLVLHGGTGIPTEQIQRAISLGTSKINVNTENQMAF 240
261420791 161 CEELVKRTGVDCLAPALGSVHGPYKGEPKLGFAEMEQIRDLTGVPLVLHGGTGIPTEQIQRAISLGTSKINVNTENQMAF 240
297531586 161 CEELVKRTGVDCLAPALGSVHGPYKGEPKLGFAEMEQIRDLTGVPLVLHGGTGIPTEQIQRAISLGTSKINVNTENQMAF 240
30265359  241 TKAVREVLNKDQEVYDPRKFIGPGRDAIKATVIGKIREFGSNGKA 285
52140227  241 TKAVREVLNKDQEVYDPRKFIGPGRDAIKATVIGKIREFGSNGKA 285
218900461 241 TKAVREVLNKDQEVYDPRKFIGPGRDAIKATVAGKMREFGSNGKA 285
301056803 241 TKAVREVLNKDQEVYDPRKFIGPGRDAIKATVIGKMREFGSNGKA 285
56421921  241 TKVVRELLAKDPNVYDPRKIIGPGRDAIKATVIGKMREFGSSGKA 285
138896962 241 TKVVRELLAKDANVYDPRKIIGPGRDAIKATVIGKMREFGSSGKA 285
163943023 241 TKAVREALNKDQEVYDPRKYIGPGRDAIKATVAGKMREFGSNGKA 285
239828615 241 TKVVRELLAKDEKVYDPRKIIGPGRDAIKATVIGKMREFGSSGKA 285
261420791 241 TKVVRELLAKDPNVYDPRKIIGPGRDAIKATVIGKMREFGSSGKA 285
297531586 241 TKVVRELLAKDPNVYDPRKIIGPGRDAIKATVIGKMREFGSSGKA 285
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap