Conserved Protein Domain Family
PRK07696

?
PRK07696: PRK07696 
thiamine biosynthesis protein ThiS
Statistics
?
PSSM-Id: 169065
View PSSM: PRK07696
Aligned: 26 rows
Threshold Bit Score: 106.353
Threshold Setting Gi: 163938653
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30260879   1 MNLKINGNQIEVPESVKTVAELLTHLELDNRIVVVERNKDILQKDDHTDTSVFDGDQIEIVTFVGGG 67 
225862709  1 MNLKINGNQIEVPESVKTVAELLTHLELDNRIVVVERNKDILQKDDHTDTSVFDGDQIEIVTFVGGG 67 
301052376  1 MNLKINGNQIEVPESVKTVAELLTHLELDNRIVVVERNKDILQKDDHTDTSVFDGDQIEIVTFVGGG 67 
118476406  1 MNLKINGNQIEVPESVKTVAELLTHLELDNRIVVVERNKDILQKDDHTDTSVFDGDQIEIVTFVGGG 67 
56419159   1 MTLVINGETVAVPDEVKTVGDLLAHFRLENKLCIVEVNVRIIQKHEYGTTVLCDGDRVEIVHFVGGG 67 
138894211  1 MTLIVNGETITVPDEVKTVSDLLSHFRLDNKLAIVEVNVRIIQKHEYGITTLANGDRVEIVHFVGGG 67 
163938653  1 MNLKINGNQIEVPESIKTVAGLLTHLELDNRIVVVERNKDILQKDDHNDTSVFDGDQIEIVTFVGGG 67 
239826149  1 MELIINGESIHVPDEVKTVSDLLAHFQLNNKIAIVEVNLTIIPKQQYETTTLCNGDKVEIVHFVGGG 67 
261418857  1 MTLVINGEAVAVPDEVKTVGDLLAHFRLENKLCIVEVNVRIIQKHEYETTALCDGDRVEIVHFVGGG 67 
297531180  1 MTLVINGEAVAVPDEVKTVGDLLAYFRLENKLCIVEVNVRIIQKHEYETTALCDGDRVEIVHFVGGG 67 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap