Conserved Protein Domain Family
PRK07667

?
PRK07667: PRK07667 
uridine kinase; Provisional
Statistics
?
PSSM-Id: 169051
View PSSM: PRK07667
Aligned: 24 rows
Threshold Bit Score: 282.004
Threshold Setting Gi: 15612883
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15612883    1 MSLLEVTEALCAHGPNDrpFIVGIDGLGGAGKTTFVKKLSRELKNWHHEVIVLPLDDYIVETKKRYETGYEEWYEYYYLQ 80 
42782101    1 MSTNELITIMKKHRENR--FILGIDGLSRSGKTTFVANLKENMKQESIPFHIFHIDDHIVERNKRYNTGFEEWYEYYYLQ 78 
30021106    1 MSTNELINVMKKHKENR--FILGIDGLSRSGKTTFVANLKENMKQEGIPFHIFHIDDHIVERNKRYHTGYEEWYEYYYLQ 78 
218898073   1 MSTNELIKIMKKHRENR--FILGIDGLSRSGKTTFVANLKENMKQEGIPFHIFHIDDHIVERNKRYHTGYEEWYEYYCLQ 78 
218230980   1 MSTNELINVMKKHKENR--FILGIDGLSRSGKTTFVANLKENMKQEGIPFHIFHIDDHIVERNKRYHTGYEEWYEYYYLQ 78 
56418714    5 DRIDFLCKTILAIKTAGr-LVLGIDGLSRSGKTTLANQLSQTLREQGISVCVFHMDDHIVERAKRYHTGNEEWFEYYYLQ 83 
296503521   1 MSTNELITIMKKHRENR--FILGIDGLSRSGKTTFVANLKENMKQEGIPFRIFHIDDHIVERNKRYHTGYEEWYEHYYLQ 78 
138894965   5 DNLLTLLDKIPKIEEGNr-FVLGIDGLSRSGKTTFVSKLKQVLQEKNVPVSIFHIDDYIVERKRRYNTGNEEWYEYYYLQ 83 
163940746   1 ------MKVIKEHKDER--FVLGIDGLSRSGKTTLVKELEEDMKESGIPFHIFHIDDHITECNKRYHTGFAEWYEYYNLQ 72 
297528531   3 DRIDFLCKTILAIKTAGr-LVLGIDGLSRSGKTTLANQLSQTLREQGISVCVFHMDDHIVERAKRYHTGNEEWFEYYYLQ 81 
15612883   81 WDIRLLETELFKKLRNNsTDLTLPYYDRATDTIMPQHIHLTSSTIVLIEGVFLQRDEWRDYFDYVLFIDCSREVRAERVL 160
42782101   79 WDIEWLRQKFFQKLQNE-TRLKLPFYHDEVDLCEMKKVQIPIVGVIVIEGVFLQRKEWRDFFHYMVYLDCPRETRFLRES 157
30021106   79 WDIEWLRQKFFQKLQHE-TKLKLPFFHEETDICEMEKVQIPIVGVIVIEGVFLQRKEWRDFFHYMVYLDCPREIRFLRES 157
218898073  79 WDIPYLRQKFFQKLQHE-TKLTLPFYQEETDSCEMKKVQIPIVGVIVIEGVFLQRKEWRDFFHYMVYLDCPRETRFLRES 157
218230980  79 WDIEWLRQKFFQKLQHE-TKLKLPFFHEETDICEMEKVQIPIVGVIVIEGVFLQRKEWRDFFHYMVYLDCPRETRFLRES 157
56418714   84 WDVEWLTHQLFRQLKAS-HQLTLPFYDHETDTHSKRTVYLSDSDMIMIEGVFLQRKEWRPFFDFVVYLDCPREIRFAREN 162
296503521  79 WDIEWLRRKFFQKLQHE-TKLKLPFFHEETDICEMEKVQIPIVGVIVIEGVFLQRKEWRDFFHYMVYLDCPRETRFLRES 157
138894965  84 WDVEWLKDNFFKKLKIS-NELHLPIYDNHSDTHKVQKVNIPRTCLIIIEGVFLQRREWKNFYDFMVYIDCPRDKRFNRES 162
163940746  73 WDIDWLQRNLFQKLQND-IKLELPFYHDETNSCELKEIQIPLVGVIVVEGVFLQRIEWREFFHYMVYLDCSRQTRFLRES 151
297528531  82 WDVEWLTHQLFRQLKAS-HQLTLPFYDHETDTHSKRTVYLSDSDMIMIEGVFLQRKEWRPFFDFVVYLDCPREIRFAREN 160
15612883  161 NrdlyigDYQTRVNKYKNRYWLAEEHYIKSVEPKKKADGLYS 202
42782101  158 P------ETQKNLSKFKNRYWKAEDYYLETELPKDRADVVIK 193
30021106  158 E------ETQKNLSKFENRYWKAEDYYLETELPRDRADLVIE 193
218898073 158 E------KTQKNLSKFENRYWKAEDYYLEMELPKDRADLVIE 193
218230980 158 E------ETQKNLSKFENRYWKAEDYYLETELPRDRADLVIE 193
56418714  163 D------QVKQNIQKFINRYWKAEDYYLETEEPIKRADVVFD 198
296503521 158 E------KTQKNLSKFENRYWKAEDYYLKTELPRDRADLVIE 193
138894965 163 D------YTKSNIEKFKKRYWKAEDYYLKTEAPKKQADLVLQ 198
163940746 152 V------ETQRNLSKFQNRYWKAEDYYLEKESPKERANLIIH 187
297528531 161 D------QAKQNIQKFINRYWKAEDYYLETEEPIKRADVVFD 196
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap