Conserved Protein Domain Family
PRK07594

?
PRK07594: PRK07594 
EscN/YscN/HrcN family type III secretion system ATPase
Statistics
?
PSSM-Id: 136438
View PSSM: PRK07594
Aligned: 17 rows
Threshold Bit Score: 799.165
Threshold Setting Gi: 85059279
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
205352869   1 MKNELMQRLRLKYPPPDGYCRWGRIQDVSATLLNAWLPGVFMGELCCIKPGEELAEVVGINGSKALLSPFTSTIGLHCGQ 80 
194450969   1 MKNELMQRLRLKYPPPDGYCRWGRIQDVSATLLNAWLPGVFMGELCCIKPGEELAEVVGINGSKALLSPFTSTIGLHCGQ 80 
161503491   1 MKNELMQCLRLKYPPPDGYRRWGRIQDISATLLNAWLPGVFMGELCCIKPGGEFAEVVGINGSKALLSPFTSTVGLHCGQ 80 
56413614    1 MKNELMQRLRLKYPPPDGYCRWGRIQDVSATLLNAWLPGVFMGELCCIKPGEELAEVVGINGSKALLSPFTSTIGLHCGQ 80 
197362538   1 MKNELMQRLRLKYPPPDGYCRWGRIQDVSATLLNAWLPGVFMGELCCIKPGEELAEVVGINGSKALLSPFTSTIGLHCGQ 80 
224584074   1 MKNELMQRLRLKYPPPDGYCRWGRIQDVSATLLNAWLPGVFMGELCCIKPGEELAEVVGINGSKALLSPFTSTTGLHCGQ 80 
197249395   1 MKNELMQRLRLKYPPPDGYCRWGRIQDVSATLLNAWLPGVFMGELCCIKPGEELAEVVGINGSKALLSPFTSTIGLHCGQ 80 
29141744    1 MKNELMQRLRLKYPPPDGYCRWGRIQDVSATLLNAWLPGVFMGELCCIKPGEELAEVVGINGSKALLSPFTSTIGLHCGQ 80 
16760496    1 MKNELMQRLRLKYPPPDGYCRWGRIQDVSATLLNAWLPGVFMGELCCIKPGEELAEVVGINGSKALLSPFTSTIGLHCGQ 80 
62180006    1 MKNELMQRLRLKYPPPDGYCRWGRIQDVSATLLNAWLPGVFMGELCCIKPGEELAEVVGINGSKALLSPFTSTAGLHCGQ 80 
205352869  81 QVMALRRSHQVPVGEALLGRVIDGFGRPLDGRELPDVCWKDYDAMPPPAMVRQPITQPLMTGIRAIDSVATCGEGQRVGI 160
194450969  81 QVMALRRRHQVPVGEALLGRVIDGFGRPLDGRELPEVCWKDYDAMPPPAMVRQPITQPLMTGIRAIDSVATCGEGQRVGI 160
161503491  81 QVMALRRRHQVPVGEVLLGRVIDGFGRPLDGSELPEVCWKDYDAMPPPAMVRRPMTQPLMTGIRAIDSVATCGEGQRVGI 160
56413614   81 QVMALRRRHQVPVGEALLGRVIDGFGRPLDGRELPEVCWKDYDAMPPPAMVRQPITQPLMTGIRAIDSVATCGEGQRVGI 160
197362538  81 QVMALRRRHQVPVGEALLGRVIDGFGRPLDGRELPEVCWKDYDAMPPPAMVRQPITQPLMTGIRAIDSVATCGEGQRVGI 160
224584074  81 QVMALRRRHQVPVGEALLGRVIDGFGRPLDGRELPEVCWKDYDAMPPPAMVRQPITQPLMTGIRAIDSVATCGEGQRVGI 160
197249395  81 QVMALRRRHQVPVGEALLGRVIDGFGRPLDGRELPDVCWKDYDAMPPPAMVRQPITQPLMTGIRAIDSVATCGEGQRVGI 160
29141744   81 QVMALRRRHQVPVGEALLGRVIDGFGRPLDGCELPDVCWKDYDAMPPPAMVRQPITQPLMTGIRAIDSVATCGEGQRVGI 160
16760496   81 QVMALRRRHQVPVGEALLGRVIDGFGRPLDGCELPDVCWKDYDAMPPPAMVRQPITQPLMTGIRAIDSVATCGEGQRVGI 160
62180006   81 QVMALRRRHQVPVGEALLGRVIDGFGRPLDGRELPEVCWKDYDAMPPPAMVRQPITQPLMTGIRAIDSVATCGEGQRVGI 160
205352869 161 FSAPGVGKSTLLAMLCNAPDADSNVLVLIGERGREVREFIDFTLSEETRKRCVIVVATSDRPALERVRALFVATTIAEFF 240
194450969 161 FSAPGVGKSTLLAMLCNAPDADCNVLVLIGERGREVREFIDFTLSEETRKRCVIVVATSDRPALERVRALFVATTIAEFF 240
161503491 161 FSAPGVGKSTLLAMLCNAPGADVNVLVLIGERGREVREFIDFTLTKESRKRCVIVVATSDRPALERVRALFVATTIAEFF 240
56413614  161 FSAPGVGKSTLLAMLCNAPDADSNVLVLIGERGREVREFIDFTLSEETRKRCVIVVATSDRPALERVRALFVATTIAEFF 240
197362538 161 FSAPGVGKSTLLAMLCNAPDADSNVLVLIGERGREVREFIDFTLSEETRKRCVIVVATSDRPALERVRALFVATTIAEFF 240
224584074 161 FSAPGVGKSTLLAMLCNAPDADSNVLVLIGERGREVREFIDFTLSEETRKRCVIVVATSDRPALERVRALFVATTIAEFF 240
197249395 161 FSAPGVGKSTLLAMLCNAPDADCNVLVLIGERGREVREFIDFTLSEETRKRCVIVVATSDRPALERVRALFVATTIAEFF 240
29141744  161 FSAPGVGKSTLLAMLCNAPDADCNVLVLIGERGREVREFIDFTLSEETRKRCVIVVATSDRPALERVRALFVATTIAEFF 240
16760496  161 FSAPGVGKSTLLAMLCNAPDADCNVLVLIGERGREVREFIDFTLSEETRKRCVIVVATSDRPALERVRALFVATTIAEFF 240
62180006  161 FSAPGVGKSTLLAMLCNAPDADSNVLVLIGERGREVREFIDFTLSEETRKRCVIVVATSDRPALERVRALFVATTIAEFF 240
205352869 241 RDNGKRVVLLADSLTRYARAAREIALAAGETAVSGEYPPGVFSALPRLLERTGMGEKGSITAFYTVLVEGDDMNEPLADE 320
194450969 241 RDNGKRVVLLADSLTRYARAAREIALAAGETAVSGEYPPGVFSALPRLLERTGMGEKGSITAFYTVLVEGDDMNEPLADE 320
161503491 241 RDHGKRVVLLADSLTRYARAAREIALAAGETAVSGEYPPGVFSALPRLLERTGMGEKGSITAFYTVLVEGDDMNEPLADE 320
56413614  241 RDNGKRVVLLADSLTRYARAAREIALAAGETAVSGEYPPGVFSALPRLLERTGMGEKGSITAFYTVLVEGDDMNEPLADE 320
197362538 241 RDNGKRVVLLADSLTRYARAAREIALAAGETAVSGEYPPGVFSALPRLLERTGMGEKGSITAFYTVLVEGDDMNEPLADE 320
224584074 241 RDNGKRVVLLADSLTRYARAAREIALAAGETAVSGEYPPGVFSALPRLLERTGMGEKGSITAFYTVLVEGDDMNEPLADE 320
197249395 241 RDNGKRVVLLADSLTRYARAAREIALAAGETAVSGEYPPGVFSALPRLLERTGMGEKGSITAFYTVLVEGDDMNEPLADE 320
29141744  241 RDNGKRVVLLADSLTRYARAAREIALAAGETAVSGEYPPGVFSALPRLLERTGMGEKGSITAFYTVLVEGDDMNEPLADE 320
16760496  241 RDNGKRVVLLADSLTRYARAAREIALAAGETAVSGEYPPGVFSALPRLLERTGMGEKGSITAFYTVLVEGDDMNEPLADE 320
62180006  241 RDNGKRVVLLADSLTRYARAAREIALAAGETAVSGEYPPGVFSALPRLLERTGMGEKGSITAFYTVLVEGDDMNEPLADE 320
205352869 321 VRSLLDGHIVLSRRLAERGHYPAIDVLATLSRVFPVVTSHEHRQLAAILRRRLALYQEVELLIRIGEYQRGVDTDTDKAI 400
194450969 321 VRSLLDGHIVLSRRLAERGHYPAIDVLATLSRVFPVVTSHEHRQLAAILRRCLALYQEVELLIRIGEYQRGVDTDTDKAI 400
161503491 321 VRSLLDGHIVLSRRLAEMGHYPAIDVLATLSRVFPAVTSPEHRQLATTLRRHLALYQDVELLIRIGEYQRGVDAAADKAI 400
56413614  321 VRSLLDGHIVLSRRLAERGHYPAIDVLATLSRVFPVVTSHEHRQLAAILRRCLALYQEVELLIRIGEYQRGVDTDTDKAI 400
197362538 321 VRSLLDGHIVLSRRLAERGHYPAIDVLATLSRVFPVVTSHEHRQLAAILRRCLALYQEVELLIRIGEYQRGVDTDTDKAI 400
224584074 321 VRSLLDGHIVLSRRLAERGHYPAIDVLATLSRVFPVVTSHEHRQLAAILRRRLALYQEVELLIRIGEYQRGVDTDTDKAI 400
197249395 321 VRSLLDGHIVLSRRLAERGHYPAIDVLATLSRVFPVVTSHEHRQLAAILRRCLALYQEVELLIRIGEYQRGVDTDTDKAI 400
29141744  321 VRSLLDGHIVLSRRLAERGHYPAIDVLATLSRVFPVVTSHEHRQLAAILRRRLALYQEVELLIRIGEYQRGVDTDTDKAI 400
16760496  321 VRSLLDGHIVLSRRLAERGHYPAIDVLATLSRVFPVVTSHEHRQLAAILRRRLALYQEVELLIRIGEYQRGVDTDTDKAI 400
62180006  321 VRSLLDGHIVLSRRLAERGHYPAIDVLATLSRVFPVVTSHEHRQLAAILRRRLALYQEVELLIRIGEYQRGVDTDTDKAI 400
205352869 401 DTYPDICTFLRQSKDEVCGPELLIEKLHQILTE 433
194450969 401 DTYPDICTFLRQSKDEVCGPELLIEKLHQILTE 433
161503491 401 DTYPNICTFLRQSKDEVCGPELLIEKLQQILTE 433
56413614  401 DAYPDICTFLRQSKDEVCGPELLIEKLHQILTE 433
197362538 401 DAYPDICTFLRQSKDEVCGPELLIEKLHQILTE 433
224584074 401 DTYPDICTFLRQSKDEVCGPELLIEKLHQILTE 433
197249395 401 DTYPDICTFLRQSKDEVCGPELLIEKLHQILTE 433
29141744  401 DTYPDICTFLRQSKDEVCGPELLIEKLHQILTE 433
16760496  401 DTYPDICTFLRQSKDEVCGPELLIEKLHQILTE 433
62180006  401 DTYPDICTFLRQSKDEVCGPELLIEKLHQILTE 433
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap