Conserved Protein Domain Family
PRK07588

?
PRK07588: PRK07588 
FAD-binding domain
Statistics
?
PSSM-Id: 169028
View PSSM: PRK07588
Aligned: 18 rows
Threshold Bit Score: 625.222
Threshold Setting Gi: 258652776
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118497640   2 KKIAINGTGISGLTLAWWLRKYGFEPTLFEKASELRNGGYLVDFWGPACEIMKKMGLFDQLKEKSYQIKNIHCFDENGRR 81 
56707757    6 EKIAINGTGISGLTLAWWLRKYGFEPTLFEKASELRNGGYLVDFWGPACEIMKKMGLFDQLKEKSYQIKNIHCFDENGRR 85 
110670228   6 EKIAINGTGISGLTLAWWLRKYGFEPTLFEKASELRNGGYLVDFWGPACEIMKKMGLFDQLKEKSYQIKNIHCFDENGRR 85 
134302061   2 KKIAINGTGISGLTLAWWLRKYGFEPTLFEKASELRNGGYLVDFWGPACEIMKKMGLFDQLKEKSYQIKNIHCFDENGRR 81 
241518177   1 MKVAINGAGIAGPTLAYWLRHYGHEPVLIEQAPRLRSGGYVVDFWGAGYDVASMMGLRPRLHELGYDVEQVRFVGSEGRQ 80 
118471301   1 MRIAISGAGIAGPTLAYWLMRAGHEPTLIEAAPRLRTGGYVVDFWGLGYEVACRMGIEPALREQGYDITAIRSVTPDGRI 80 
148821776   1 MKVAISGAGVAGAALAHWLQRTGHTPTVIERAPKFRTGGYMIDFWGVGYQVAKRMGITDQIAAAGYHMEHVRSVGPTGKV 80 
148660344   1 MKVAISGAGVAGAALAHWLQRTGHTPTVIERAPKFRTGGYMIDFWGVGYQVAKRMGITDQIAAAGYHMEHVRSVGPTGKV 80 
253797508   1 MKVAISGAGVAGAALAHWLQRTGHTPTVIERAPKFRTGGYMIDFWGVGYQVAKRMGITDQIAAAGYHMEHVRSVGPTGKV 80 
258650644   1 MKVLIVGAGIAGPTLAYWLLRAGHQPTLVERAPELRHGGYVIDFWGAGFEVAERMGIAEELRGRGYRFRQVRVVDRRGHR 80 
118497640  82 SSKVNISSLITDNYDEFLSVKRGDIAETIYKACQG-IDIRFATSIDKIEEKDNHITTHLSDGTKEDFDLVIGADGLHSHI 160
56707757   86 SSKVNISSLITDNYDEFLSVKRGDIAETIYKACQG-IDIRFATSIDKIEEKDNHITTHLSDGTKEDFDLVIGADGLHSHI 164
110670228  86 SSKVNISSLITDNYDEFLSVKRGDIAETIYKACQG-IDIRFATSIDKIEEKDNHITTHLSDGTKEDFDLVIGADGLHSHI 164
134302061  82 SSKVNISSLITDNYDEFLSVKRGDIAETIYKACQG-IDIRFATSIDKIEEKDNHITTHLSDGTKEDFDLVIGADGLHSHI 160
241518177  81 CSAFSTDAIRRKLGGRFVSLKRSDLAAVIYAALDGkVETIFDDSIAMIDEGSAGVHVCFNRHGDETFDLVVGADGLHSRV 160
118471301  81 RANLDTAGIRRVTHDKFTSLPRGDLAATIYSTIDGkVETVFGDSIASITEHEDGVAVGLAGGTQREFDLVVGADGLHSHV 160
148821776  81 KADLGVDVFRRMVGDDFTSLPRGDLAAAIYTTIEDqVETIFDDSIATIDEHRDGVRLTFERTAPRDFDLVIGADGLHSNV 160
148660344  81 KADLGVDVFRRMVGDDFTSLPRGDLAAAIYTTIEDqVETIFDDSIATIDEHRDGVRLTFERTAPRDFDLVIGADGLHSNV 160
253797508  81 KADLGVDVFRRMVGDDFTSLPRGDLAAAIYTTIEDqVETIFDDSIATIDEHRDGVRLTFERTAPRDFDLVIGADGLHSNV 160
258650644  81 FASFRPASIVGPM-DRYVSIARSELARVIYDSLDGaVELILGDTVRTLCDESDRVRVEFGSGDVRHFDLVVGADGLHSRV 159
118497640 161 RSLVFDKSEYQEYELDKYVAALSLKNYNHYEKYTYAISVGDKKQVARVCLDENETLVMFIIDSSlVNNFPLTLAEKKQLL 240
56707757  165 RSLVFDKSEYQEYELDKYVAALSLKNYNHYEKYTYAISVGDKKQVARVCLDENETLVMFIIDLSlVNNFPLTLAEKKQLL 244
110670228 165 RSLVFDKSEYQEYELDKYVAALSLKNYNHYEKYTYAISVGDKKQVARVCLDENETLVMFIIDLSlVNNFPLTLAEKKQLL 244
134302061 161 RSLVFDKSEYQEYELDKYVAALSLKNYNHYEKYTYAISVGDKKQVARVCLDENETLVMFIIDLSlVNNFPLTLAEKKQLL 240
241518177 161 RELQFGPVGQFEVYLGYKAAAFELQGYPLRDERTYVSYAEPGRQISRFSMRDGWTLFLLVYKDP-NRDIPLTHVGRKEAL 239
118471301 161 RQLAFGRAPDPEHYLGCLVAAAVVDGYRPRDDLVYMTFSAPGHSVGRVALRGDRTLFLFILRSD-DATVPGSHDERIALL 239
148821776 161 RRLVFGPERDFEHYLGCKVAACVVDGYRPRDERSYVLYNTVDRQLARFALRGDRTMFLFVFRAE-HDNPGVAPKDE---L 236
148660344 161 RRLVFGPERDFEHYLGCKVAACVVDGYRPRDERSYVLYNTVDRQLARFALRGDRTMFLFVFRAE-HDNPGVAPKDE---L 236
253797508 161 RRLVFGPERDFEHYLGCKVAACVVDGYRPRDERSYVLYNTVDRQLARFALRGDRTMFLFVFRAE-HDNPGVAPKDE---L 236
258650644 160 RRLAFGADAQFEKYLGIVFAAFQAQGYRPRDELVAMMHAEIGFQAVRLSLRQDMTLFLFTVRHL-GAVPTDDRTAQQDLL 238
118497640 241 VSSFKEFKWETPDILARLTDVDEIYFDKVSQIRMDTWYKGRVALVGDSAACPSVLMGLGSIFAIIEAYILAGELHKAKGN 320
56707757  245 VSSFKEFKWETPDILARLTDVDEIYFDKVSQIRMDTWYKGRIALVGDSAACPSVLMGLGSIFAIIEAYILAGELHKAKGN 324
110670228 245 VSSFKEFKWETPDILARLTDVDEIYFDKVSQIRMDTWYKGRIALVGDSAACPSVLMGLGSIFAIIEAYILAGELHKAKGN 324
134302061 241 VSSFKEFKWETPDILARLTDVDEIYFDKVSQIRMDTWYKGRIALVGDSAACPSVLMGLGSIFAIIEAYILAGELHKAKGN 320
241518177 240 RDAFSDAGWESPQILKRMDDTEEIYFDRVSQIQMHSWTKGRTALVGDAAACVSLLAGEGSGLAMSEAFVLAGELARARNN 319
118471301 240 KREFSDLGWECERITDALDDVDDLYLDVVSQIRMDRWSRGRTVLVGDAAACISLLGGEGTGLAMAEAYVLAGELA-AHRD 318
148821776 237 RDQFGDVGWESRDILAALDDVEDLYFDVVSQIRMDRWSRGRVLLIGDAAGCISLLGGEGTGLAITEAYVLAGELARAGGD 316
148660344 237 RDQFGDVGWESRDILAALDDVEDLYFDVVSQIRMDRWSRGRVLLIGDAAGCISLLGGEGTGLAITEAYVLAGELARAGGD 316
253797508 237 RDQFGDVGWESRDILAALDDVEDLYFDVVSQIRMDRWSRGRVLLIGDAAGCISLLGGEGTGLAITEAYVLAGELARAGGD 316
258650644 239 RAKLAGKGWETSAMLELMPQSQSFYFDSASQIRMPEWSRGRVVLVGDAAAGPSFLAGQGSALAMVESYTLAAELART-AD 317
118497640 321 YHIAFEQWQNKLKDIIARKQKVGLSNLSVAASDEIFKKYLSTITVKISSTPVISKFIGAGIFNDPIEIPEYE 392
56707757  325 YHIAFEQWQNRLKDIIARKQKVGLSNLSVAASDEIFKKYLSTITVKISSTPVISKFIGAGIFNDPIQIPEYE 396
110670228 325 YHIAFEQWQNRLKDIIARKQKVGLSNLSVAASDEIFKKYLSTITVKISSTPVISKFIGAGIFNDPIQIPEYE 396
134302061 321 YHIAFEQWQNRLKDIIARKQKVGLSNLSVAASDEIFKKYLSTITVKISSTPVISKFIGAGIFNDPIQIPEYE 392
241518177 320 PLTGLANYQTRMMPFLQDRQCAARRFASSFVPKSTFGITVRNIISSLFGFPIVGDFLLGRLLRSNLDLPRYD 391
118471301 319 HRDAFSAYETALRPLIAAKQEAARRYLAVFIPKTNLGIAFRDLCMRVVNAVPWTDRLLARTFSDDFALPEYR 390
148821776 317 HRRAFDAYEKRLRPFIEGKQASAAKFIWFFATRTRFGLWFRNVAMRTMNFGPLATLF-AGSVRDDFELPDYT 387
148660344 317 HRRAFDAYEKRLRPFIEGKQASAAKFIWFFATRTRFGLWFRNVAMRTMNFGPLATLF-AGSVRDDFELPDYT 387
253797508 317 HRRAFDAYEKRLRPFIEGKQASAAKFIWFFATRTRFGLWFRNVAMRTMNFGPLATLF-AGSVRDDFELPDYT 387
258650644 318 HREAFGRYQARLAPLLRSKQDAAQGLGLAFAPASGVQLLVRNAAMIAMGLPRVAGLVMGRSFHDSVELPEFA 389
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap