Conserved Protein Domain Family
PRK07546

?
PRK07546: PRK07546 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 169002
View PSSM: PRK07546
Aligned: 37 rows
Threshold Bit Score: 208.679
Threshold Setting Gi: 221640278
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13472644   12 TADFELIETMRWQPGTSFLRFDRHLARLYGSAAELGFACDPQRIAEVLSDALDG--ARtAMRTRLALARNGDATASAQPY 89 
33603008    1 -MQPELIETILVTADRQLPLLGRHLARLLTSCQALRYRCNEPAVESAIMAAVRGlhAPgPHRLRLLLARDGSHDIQTAPL 79 
33598115    1 -MQPELIETILVTADRQLPLLGRHLARLLTSCQALRYRCNEPAVESAIMAAVRGlhAPgPHRLRLLLARDGSHDIQTAPL 79 
33594146    1 -MQPELIETILVTADRQLPLLGRHLARLLTSCQALRYRCNEPAVESAIMAAVRGlhAPgPHRLRLLLARDGSHDIQTAPL 79 
187479283   1 -MAPELIETILVTAQRETPLLGRHLTRLAASALALGYRCDEAAIETTIMSTVQAlpGMqPQRLRLLLDRSGQCSIQTAVL 79 
146276415  16 DPELRLIETLLWD-GSRLVRLRRHLRRLEGAAARLGWRCRGAGDALKAAVPEA------PARMRLTLDREGRMAVEVVPL 88 
56695827   10 DPGFRLIETLGWHPDEGPRRAALHLARMARSAAALGMPLDQTEAQRLLDQIT----GPaPLRCRLTLGTRGALSLETAPL 85 
163855176   1 -MSPELIETLLADAEGEIPLLPRHLERLQAASDVLGYPCDALAVERDLRMAAAAlvTPgPHRLRLLLDRAGRRHIQTAAL 79 
99080475    1 -----MIETFGFAPGQGVARLDLHLARLTRSAEAFGIPFRRAKALAMVEDLA----ATtPLRCRMTLAADGFLALTTAEM 71 
197124376   1 MSGLLLLEALRWEPAAGWSLLDRHLARLAGAAAHFGHPCDPVAVRAALEGAVAG--IDdARKVRLALAADGRLTVEALP- 77 
13472644   90 EPLAADKVWILRLARTRLDSQNTLLRHKTSRRQLYTHARSEYLV-TQADEVLLANERGEICEGTITNVFADFGDGVLATP 168
33603008   80 APLPPDQ--EVMLAPEALNADEPLLRYKTTYRPWYAHTIEWLPShPRVFDLLYLNQHGELCEGSRSNVYLELGGRWY-TP 156
33598115   80 APLPPDQ--EVMLAPEALDADEPLLRYKTTYRPWYAHTIEWLPShPRVFDLLYLNQHGELCEGSRSNVYLELGGRWY-TP 156
33594146   80 APLPPDQ--EVMLAPEALDADEPLLRYKTTYRPWYAHTIEWLPShPRVFDLLYLNQHGELCEGSRSNVYLELGGRWY-TP 156
187479283  80 PPLPMVQ--EILLAPETLNSKEPLLRYKSTYRPWYAKASDWLPGhPQIFDMIFLNEKGQLCEGSRSNIYLQLDGQWY-TP 156
146276415  89 PP--AKRLWRVGLAEERLCSADPWLQVKSSRRAAYDAARAALP--EGIDELLFLNERGELCDGTITTVFFDAGEGMR-TP 163
56695827   86 AASPPH--WRVAIHPERLDADDPWLRHKTTRRALYDRARAELP--TGFDEWLFLNRAGEVCEGTITNIFADLGDGLL-TP 160
163855176  80 PPLAPGQ--QVMLSDQPLDAREPLLRYKTSHRPWYADAAAWLAAhPGVFDLLFLNQRGELCEGSRSNVYLQVRGVWY-TP 156
99080475   72 PA--AANLWRVGIAQERLASDEPLLRHKTTRREIYDRARARLP--AGIDEVIFFNERDEICEGTITNLVLTREDGTRLTP 147
197124376  78 --LPSSRPLRAALARDPVDAADPFLRFKTSRREPFERARAGR---PGADEVVLWNERGELTETTTGNLVLERGGRRV-TP 151
13472644  169 RLDCGLLPGVLRAELLDEGRAEEAIYSYDDLKSAKALFVGNSLRGLIPAKLV 220
33603008  157 PIASGCLPGVQRAELIDQGKVQERTLTMSDLRSAESIRLSNALRGWIEVQYH 208
33598115  157 PIASGCLPGVQRAELIDQGKVQERTLTMSDLRSAESIRLSNALRGWIEVQYH 208
33594146  157 PIASGCLPGVQRAELIDQGKVQERTLTMSDLRSAESIRLSNALRGWIEVQYH 208
187479283 157 PMECGLLAGVQRAALLEAGEVREHVLEVRDLRDAQAIRLSNALRGWIDVTLH 208
146276415 164 PLSSGLLPGILRESMLDAGRCREAPLPGEALPRVR-LWVGNSLRGLMVAEWA 214
56695827  161 PLASGLLPGILRAELLASGQAREACLTPQDLHEAHALYCGNALRGLIPATFA 212
163855176 157 PLASGCLPGVQRAELLDSGRAQERVLTLDDLHAADGIRLSNALRGWFDVELH 208
99080475  148 PVSSGCLPGVYRQSLLDAGSLKEAVLTMADLQRAAALHLTNALRGEIPATLF 199
197124376 152 PLTAGLLPGTFRAHLLEAGELAEAVLTVADLSRAGRIWQVSSVRGWVELRLD 203
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap