Conserved Protein Domain Family
PRK07504

?
PRK07504: PRK07504 
O-succinylhomoserine sulfhydrylase; Reviewed
Statistics
?
PSSM-Id: 168979
View PSSM: PRK07504
Aligned: 36 rows
Threshold Bit Score: 778.551
Threshold Setting Gi: 225851851
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82699229    1 MTTENARKFRPATELVHAGSLRSGFAEMSEALFLTQGFLYPTAEAAEARFKGEDPGFIYSRYANPTTDMFEKRMCALEGA 80 
27376216   22 PMSKSPATYRPETRLVHSGTLRSQFGETSEALFLTQGYVYNSAEECEARFKGEDPGFIYSRYSNPTISMFERRMIELEGA 101
92115850   27 SQSSPTAQYRTETRLVHSGTMRSQFAETSEALFLTQGYIYDTAEQCEARFKGEDPGFIYSRYSNPTVAMFEQRMAELEGA 106
75674338    2 SETKSAPRYHPETRLVHSGTLRSQFAETSEALFLTQGYVYDTAEQCEARFKGDDPGFIYSRYSNPTVAMFEQRMAALEGA 81 
39937824    8 IPVPATAHFRRETRLVHSGSLRSQFGETSEALFLTQGFVYESAEQCEARFTGDDAGFQYSRFSNPTVFSFEQRMAEFEGA 87 
115526865   4 IKAPSLSSFRRETRLVHSGTLRSQYGETSDALFLTQGFVYASAEECEARFTGDDPGFQYSRFSNPSVSAFEQRMAELEGA 83 
90426375    6 TTAPSTSAYRRETRLVHSGTLRSQYGETSDALFLTQGFVYASAEQCEARFTGDDPGFQYSRFSNPTVSAFEQRMAEFEGA 85 
91975383   13 IAIPDTAHYRRETRLVHSGSLRSQYGETSEALFLTQGFVYDSAEQCEARFTGDDPGFQYSRFSNPTVFSFEQRMAEFEGA 92 
86747917   13 IAIPDTAHFRRETRLVHSGSLRSQYGETSEALFLTQGFVYDSAEQCEARFTGDDAGFQYSRFSNPTVFSFEQRMAEFEGA 92 
192293608   8 IPVPATAHFRRETRLVHSGSLRSQFGETSEALFLTQGFVYESAEQCEARFTGDDAGFQYSRFSNPTVFSFEQRMAEFEGA 87 
82699229   81 EDARATASGMAAVAAAILCQVQAGDHVISARAVFGSCRYIVETVLPRYGVEVSIIDGSDVANWKAAVRPNTKVMFLESPS 160
27376216  102 EAARSAATGMAAVTTAILAPLKTGDHVVASRALFGSCLYVIQDLLPRYGIETTLVDGLDLDQWQRALRPNTKTFFLESPT 181
92115850  107 EAARATATGMAAVTTAMLAPLRAGDHVVAAKALFGSCRYVVEDLLPRYGIESTLVDGLDLEQWRKAMRPNTKSCFIESPT 186
75674338   82 ETARALATGMAAVTTAILAPLKAGDHVVAAKALFGSCRYVVEDLLPRYGIESTLVDGLDLDQWRKAMRPNTKTCFIESPT 161
39937824   88 EAARSTATGMAAVTAAMLAPLRAGDHVVASKAMFGSCRYVVEDLLPRYGIESTLVDGLDLDQWQRAVRPNTKTFFLESPT 167
115526865  84 EAARATASGMAAVTAAMLAPLRAGDHVVASRAMFGSCRYVVEDLLPRYGIESTLIDGLDLDQWQKALRPNTKTFFLESPT 163
90426375   86 EAARATATGMAAVTAALLAPLRAGDHVVASKAMFGSCRYVVEDLLPRYGIESTLVDGLDLDQWQKALRPNTKTFFLESPT 165
91975383   93 EAARATATGMAAVTAAMLAPLRAGDHVVASKAMFGSCRYVVEDLLPRYGIESTLVDGLDLDQWQRAVRPNTKTFFLESPT 172
86747917   93 EAARATATGMAAVTAAMLAPLRAGDHVVASKAMFGSCRYVVEDLLPRYGIESTLVDGLDLDQWQKALRPNTRTCFLESPT 172
192293608  88 EAARSTATGMAAVTAAMLAPLRAGDHVVASKAMFGSCRYVVEDLLPRYGIESTLVDGLDLDQWQRAVRPNTKTFFLESPT 167
82699229  161 NPTLEIIDIAAVAQIANEAGAKLIVDNVFATPLFQKPLELGAHIVVYSATKHIDGQGRCLGGVVLSDREWIETTLQDYFR 240
27376216  182 NPTLDVLDIPGIAEIAHKGGARLVVDNVFATPIWQSPLALGADVVVYSATKHIDGQGRCLGGIILSSEAFVAEHLHNFMR 261
92115850  187 NPTLDVLDIGGIAEIAHQAGARLIVDNVFATPIWQSPLALGADIVVYSATKHIDGQGRTLGGVILCSNAFVQEHLQTFIR 266
75674338  162 NPTLDVLDIGGIAEIAHQAGARLIVDNVFATPIWQSPLALGADVVVYSATKHIDGQGRTLGGVILSSNAFVQEHLQTFIR 241
39937824  168 NPTLDVLDIGAIAEIAHAAGARLVVDNVFATPIWQSPLQLGADVVVYSATKHIDGQGRCLGGVVLSSQAFIEEHIQMYLR 247
115526865 164 NPTLDVLDIGAIAEIAHAGGAKLVVDNVFATPIWQSPLELGADVVVYSATKHIDGQGRCLGGVVLASQAFIEEHIQMFIR 243
90426375  166 NPTLDVLDIGEIAKIAHAGGARLVVDNVFATSLWQSPLELGADVVVYSATKHIDGQGRCLGGVVLASNAFIEEHIQMYLR 245
91975383  173 NPTLDVLDIGAIAQIAHAGGARLVVDNVFATPIWQSPLELGADVVVYSATKHIDGQGRCLGGVVLASQAFIEEHIQMYLR 252
86747917  173 NPTLDVLDIGAIAEIAHAGGARLVVDNVFATPIWQSPLALGADVVVYSATKHIDGQGRCLGGVVLSTQAFIEEHIQMYLR 252
192293608 168 NPTLDVLDIGAIAEIAHAAGARLVVDNVFATPIWQSPLQLGADVVVYSATKHIDGQGRCLGGVVLSSQAFIEEHIQMYLR 247
82699229  241 HTGPGLSPFNAWIMLKGLETLSVRVRQQTQSAAAIADFLAGKPGVKRVIYPGRADHPQADIIAKQMTGGSTLIALELEGG 320
27376216  262 QTGPSISPFNAWVLLKGLETLAVRVRAQTDTAASVAEVLAGHPKISRLIYPGRADHPQAALVKKQMRGGSTLVGFEVKGG 341
92115850  267 QTGPSISPFNAWVLLKGLETLGVRVRQQTESAAAIADALASHPKVSRLIYPGRPDHPQAALVKKQMRAGSTLIGFEVKGG 346
75674338  242 QTGPSISPFNAWILLKGLETLGVRVRQQTDSAAAIAEVLASHPKVSRLVYPGRPDHPQAALVKKQMRAGSTLIGFEVKGG 321
39937824  248 QTGPSLSPFNAWVLLKGLETLAVRVEKQTSNAAAIADALAGQPKVPRLVYPGRADHPQAATVKKQMGAGSTLVGFEVKGG 327
115526865 244 QTGPSLSPFNAWVMIKGLETLAVRVEQQTKNAAAIAEALAGHPKISRLVFPGRDDHPQAATVKKQMRGGSTLVGFEIKGG 323
90426375  246 QTGPSLSPFNAWVLLKGLETLAIRVEKQTTNAAAVADALAGHPKITRLIYPGRDDHPQAVTVKKQMRAGSTLVGFDVKGG 325
91975383  253 QTGPSLSPFNAWVLLKGLETLSVRVRQQTETAAAIADALAIHPKVARLIYPGRADHPQAETVKKQMGAGSTLVGFEVKGG 332
86747917  253 QTGPSLSPFNAWVLLKGLETLAVRVRAQTETAAAIADALAGHPKIPRLVYPGRADHPQAATVKKQMGAGSTLIGFEVAGG 332
192293608 248 QTGPSLSPFNAWVLLKGLETLAVRVEKQTSNAAAIADALAGHPKVPRLVYPGRADHPQAATVKKQMGAGSTLVGFEVKGG 327
82699229  321 KEAAFKFENALQIFSITNNLGDTKSLITHPATTTHKNLSNEAKAELGISDGLLRVSVGLEDTDDLLEDVEVALKVA 396
27376216  342 KAAAFRVLNELKLAKISNNLGDAKSLVTHPATTTHQRLKPEDRAALGISEGFIRFSAGLEHADDLIEDLTAALEKA 417
92115850  347 KAGAFRCLNALKLARISNNLGDAKSLVTHPATTTHQRLAPEVRVGLGIGEGFIRYSAGLEHKDDLIEDLVAALETV 422
75674338  322 KAAAFRCLNALKIARISNNLGDAKSLVTHPATTTHQRLAPEIRAGLGIGESFIRYSVGLEHKDDLIEDLVTALEKA 397
39937824  328 KAEAFRFLNALKLVKISNNLGDAKSLVTHPATTTHQRLKPEARAELGISEGFIRLSAGLEHKDDLIEDLLAALDKV 403
115526865 324 KEAAFRFLNALKLTKISNNLGDAKSLVTHPATTTHQRLKPEIRAELGIGAGFIRYSAGLEHQDDLIDDALAALEQA 399
90426375  326 KQGAFRFLNALKLTLISNNLGDARSLVTHPATTTHQRLKPEVRADLGISEGFIRYSAGLEHKDDLIEDLLAALQQV 401
91975383  333 KAEAFRFLNALKLVKISNNLGDAKSLVTHPATTTHQRLKPEARAELGISEGFIRYSAGLEHKDDLIEDLIAALDHV 408
86747917  333 KAEAFRFLNALKLIRISNNLGDAKSLVTHPATTTHQRLKPEARAELGISEGFIRYSVGLEHKDDLIEDIVAALEKV 408
192293608 328 KAEAFRFLNALKLVKISNNLGDAKSLVTHPATTTHQRLKPEARAELGISEGFIRLSAGLEHRDDLIEDLLAALDKV 403
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap