Conserved Protein Domain Family
PRK07481

?
PRK07481: PRK07481 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 168967
View PSSM: PRK07481
Aligned: 44 rows
Threshold Bit Score: 789.258
Threshold Setting Gi: 121610078
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
238023578   1 MDYQQRQKRFWHPMSSAAAGHTTPTVVIARGDGNYVFDVEGHRMLDGVGGLWNVNVGHNRPEVKSAIARQMDELSYYQTF 80 
227820234   6 FLIENNARHLWHPMAHPAEMQACPPRIVNAAEGVEIVDIHGKKVLDAVGGLWNVNLGYSSDPVKKAIRDQLDELPYYSTF 85 
209546515   6 FIIENNARHMWHPMAHPAEMQAQPPRIITAGEGVEIVDIQGKKVLDAVGGLWNVNLGYSCEPVKKAIHDQLDELPYYSTF 85 
23500879    6 FLIENNARHLWHPMAHPAEMQANPPRIVNGGEGVEVIDIHGKKVLDAVGGLWNVNLGYSCEPVKKAIRDQLDSLPYYSTF 85 
56709134    6 FIKENNARQFWQPMTHPADAQANPPKIITGAAGVRIRDIDGHETIDAVGGLWNVNLGYSNDAVKQAITGQLDSLPYYSTF 85 
99078689   10 FLKEHNARSLWHPMAHPGDSLANPPTIVTGASGVRIKDVDGHEVVDAVGGLWNVNLGFSCQPVKDAIAAQLDVLPYYSIF 89 
89056003    6 FLKENNGRLMWHPMTSPKDSIDTPPKIVTEGHGVRIKDIDGHEVVDAVGGLWNVNLGYSCQPVKDAISAQLDRLPYYSTF 85 
256015925   6 FLIENNARHLWHPMAHPAEMQANPPRIVNGGEGVEVIDIHGKKVLDAVGGLWNVNLGYSCEPVKKAIRDQLDSLPYYSTF 85 
17988474    6 FLIENNARHLWHPMAHPAEMQANPPRIVNGGEGVEVIDIHGKKVLDAVGGLWNVNLGYSCEPVKKAIRDQLDSLPYYSTF 85 
225686909   6 FLIENNARHLWHPMAHPAEMQANPPRIVNGGEGVEVIDIHGKKVLDAVGGLWNVNLGYSCEPVKKAIRDQLDSLPYYSTF 85 
238023578  81 DGVAHPRVYDLADRLCAMFAREDMQRVMFGSGGSDAIETALKMARQYWVAAGEPSRTKFLSLRNGYHGVHMGGTSIGGNG 160
227820234  86 RGTTNSPLIELSCELAEWFKEDGLTRSFFTSGGSDSVETCLRLARQYHKINGQPERTKFVALKKGYHGTHFGGASVNGNQ 165
209546515  86 RGTTNSPLIELSYELAEWFRPDGLSRSFFTSGGSDSVETCLRLARQYHKIAGQPERTKFVALKKGYHGTHFGGASVNGNQ 165
23500879   86 RGTTNSPLIELSYELAEFFKEDGLTRAFFTSGGSDSVETALRLARQFHKINGQPERTKFVSLKKGYHGTHFGGASVNGNA 165
56709134   86 RGTTNDAAIELAYDLCDFFAEEGIQRVFYTSGGSDSVETALRLARQYHKLRGQPQRTKFLSLKKGYHGTHFGGASVNGNN 165
99078689   90 RGTTNDQVIQLAEELRDFFAPDGLSRAFFTSGGSDSVETALRLARQYHKVRGEPARVKYLSLKKGYHGTHFGGASVNGNA 169
89056003   86 RGTSNDAAIELSYELSQFFAPDGLSRAFFTSGGSDSVETSLRLARQYHKLRGEPGRVKFLSLKKGYHGTHMGGASVNGNA 165
256015925  86 RGTTNSPLIELSYELAEFFKEDGLTRAFFTSGGSDSVETALRLARQFHKINGQPERTKFVSLKKGYHGTHFGGASVNGNA 165
17988474   86 RGTTNSPLIELSYELAEFFKEDGLTRAFFTSGGSDSVETALRLARQFHKINGQPERTKFVSLKKGYHGTHFGGASVNGNA 165
225686909  86 RGTTNSPLIELSYELAEFFKEDGLTRAFFTSGGSDSVETALRLARQFHKINGQPERTKFVSLKKGYHGTHFGGASVNGNA 165
238023578 161 VYHYNHGPLLPGCVLLDTPWLYRNPWNCEDPRQLVEHCIRQLEETIAFHGPQTIAAFVAEPVQGAGGLIVPPAEYWPRVR 240
227820234 166 NFRRNYEPLLPGVFHLPAPWAYRNPFGTSDGAEIAAAIGRLFEEEIAFQGADTIAALIVEPVLGAGGVIVPHATFLPLMR 245
209546515 166 NFRRNYEPLLPGVIHLPAPFPYRNPFGTDDGAEIAAAIGRLFEDEIAFQGADTIAALIVEPVLGAGGVIVPHETFLPLMR 245
23500879  166 NFRRNYEPLLPGVFHLAAPYPYRNPFNMDDPAAIAAAIARQFEDEIAFQGADTIAAFIMEPVLGAGGVIVPHESFMLLMR 245
56709134  166 KFRTDYEPLLPGCFHIPAPYTYRNPFNETDPARLAQLCAQALEDEIAFQGAETIAAFIMEPILGAGGVIPPHESFMPMVR 245
99078689  170 NFRTAYEPLLAGCHHIPAPYTYRNPFNETDPERLAQLCLAALEDEIAFQGAGTIAAFIMEPILGAGGVIPPHESFMPGVA 249
89056003  166 NFRTAYEPLLPGCYHIPAPYTYRNPFNETDPERLAQLCAQALEDEIAFQGASTIAAMIMEPILGAGGVIPPHKSFAPMVA 245
256015925 166 NFRRNYEPLLPGVFHLAAPYPYRNPFNMDDPAAIAAAIARQFEDEIAFQGADTIAAFIMEPVLGAGGVIVPHESFMPLMR 245
17988474  166 NFRRNYEPLLPGVFHLAAPYPYRNPFNMDDPAAIAAAIARQFEDEIAFQGADTIAAFIMEPVLGAGGVIVPHESFMPLMR 245
225686909 166 NFRRNYEPLLPGVFHLAAPYPYRNPFNMDDPAAIAAAIARQFEDEIAFQGADTIAAFIMEPVLGAGGVIVPHESFMPLMR 245
238023578 241 EVCERNGILLIADEVVTGFGRTGSLLGSRGWGVAADILCVAKGISAGYVPLGATLYNGRIAQAIEHGSGFSHVIMHGYTY 320
227820234 246 EICDRHGILLIADEVITAFGRTGAWTGSRLWGVKPDLMSTAKAITNGYYPFGAVMIADKVAEVFESSKSGVGTIGHGYTY 325
209546515 246 EICDRHGILLIADEVITAFGRTGAWTGSRLWGVKPDLMSTAKAITNGYFPFGAVMIADKVAEVFEGSKGAFGSIGHGYTY 325
23500879  246 EICDRHGILLIADEVITAFGRTGAWTGSRGWGVKPDMMTTAKAITNGYFPFGAVMISDKVASVFEANKNSLGAIGHGYTY 325
56709134  246 EICDRNGILLIADEVITAFGRTGAWSGSRLWGVQPDMMCTAKAITNGYFPFGAVLIGTRMTEVFEGDTSGKGAISHGYTY 325
99078689  250 EICRRHGILLIADEVITAFGRTGSWSGSRHWGVQPDMMCTAKAITNGYFPFGALMLSERLVEVFEKDDTGKAAIGHGYTY 329
89056003  246 EICARSGILLITDEVITAYGRTGAWTGARLWGIQPDMMATAKAITNGYFPFGAVMLGDRMVETFENNAS--AKIGHGYTY 323
256015925 246 EICDRHGILLIADEVITAFGRTGAWTGSRGWGVKPDMMTTAKAITNGYFPFGAVMISDKVASVFEANKNSLGAIGHGYTY 325
17988474  246 EICDRHGILLIADEVITAFGRTGAWTGSRGWGVKPDMMTTAKAITNGYFPFGAVMISDKVASVFEANKNSLGAIGHGYTY 325
225686909 246 EICDRHGILLIADEVITAFGRTGAWTGSRGWGVKPDMMTTAKAITNGYFPFGAVMISDKVASVFEANKNSLGAIGHGYTY 325
238023578 321 SGHPLACAASLAVLDIVESEDLPGNAARVGERLLAQLLPLKADFETVGDVR-GKGLMLALDLVTDKASRTPLDpaKGFAA 399
227820234 326 SGHPVGAAAALATLKETMRLNVAGNAAARGEELLHGLKTLENRHELVGDVR-GKGLMCALELVSDRAKKTPAS--KEVLQ 402
209546515 326 SGHPAGAAAALATLKETKRLNVADNAAARGEELIAGLKKLQDKHELIGDVR-GKGLMCALELVSDRKKKSAAS--KDILQ 402
23500879  326 SGHPVGAAAALATLKETARANTAANAGARGVELMAGLNQLKEKHELVGDVR-GKGLMAALELVSDREKKSAAA--KTVVQ 402
56709134  326 SGHPVGAAAAVVCLKETVKANVAENAATRGEELFNGLQALAAKHEMIGDVRgGHGLMAALEVVADRASKAPAG--AAMMN 403
99078689  330 SGHPVGAAAALACLAETKRLNVPENAAARGAQIFEGLQDLAARYDLIGDVRgGHGLMSALELVSDRATKAAVD--KKVIN 407
89056003  324 SGHPVGAAAALACLAETQRLNVTENATARGTQLYEGCLALQEKYDVIGDVRgGHGLMTAIEMVSDRETKAPDAasGG--- 400
256015925 326 SGHPVGAAAALATLKETARANTAANAGARGVELMAGLNQLKEKHELVGDVR-GKGLMAALELVSDREKKSAAA--KTVVQ 402
17988474  326 SGHPVGAAAALATLKETARANTAANAGARGVELMAGLNQLKEKHELVGDVR-GKGLMAALELVSDREKKSAAA--KTVVQ 402
225686909 326 SGHPVGAAAALATLKETARANTAANAGARGVELMAGLNQLKEKHELVGDVR-GKGLMAALELVSDREKKSAAA--KTVVQ 402
238023578 400 RVADAARRRGVLVRAIANKIVMSPPLTLQQNEADFMAVTLREALQECCAD 449
227820234 403 TVQDAAYEAGVLVRTSGPNVILSPPLVITTQDVARIVDALDAGLAAAEGR 452
209546515 403 KVQDVAFDAGALVRTSGGNVIMSPPLVITAEDVQTILTALDAGLTAAGA- 451
23500879  403 KVYDVAYEEGVMVRTSGANVIISPPLVITSADVNRIVSALDAGLSAAKGQ 452
56709134  404 TVYETAYGAGVMLRVSGPNIILSPPLVLSAQDVADILSALDAGFAALG-- 451
99078689  408 RLQEVAYQNGAMVRVSGPNIILSPPLVLTEADAAQILSALDAGFAAVN-- 455
89056003  401 AVQEVAYQNGAMVRVSGPNLILSPPLILTEDDAATILSALDKGFASL--- 447
256015925 403 KVYDVAYEEGVMVRTSGANVIISPPLVITPADVNRIVSALDAGLSAAKGQ 452
17988474  403 KVYDVAYEEGVMVRTSGANVIISPPLVITPADVNRIVSALDAGLSAAKGQ 452
225686909 403 KVYDVAYEEGVMVRTSGANVIISPPLVITPADVNRIVSALDAGLSAAKGQ 452
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap