Conserved Protein Domain Family
PRK07473

?
PRK07473: PRK07473 
M20/M25/M40 family metallo-hydrolase
Statistics
?
PSSM-Id: 168961
View PSSM: PRK07473
Aligned: 13 rows
Threshold Bit Score: 655.702
Threshold Setting Gi: 170747329
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
170747329   1 MIPEMIPemipdlrFDARDILATLEPWVLCESPTHDAAAVNRMMGVAARDLALLGATVETIPGRMGLSDCVRARFPHRDR 80 
158423698   1 MDLSALP-------FDTTSMLARLRPWIECESPTYDPAAVSRAVALAARDAAAAGGQVDHIPGPDGLGDCARIRFPHRDA 73 
146339918   1 MNPADLP-------FDTEAMLQGLRGWVECESPTWDAAAVERMLDLAARDMAIMGATIERIAGRQGFAGCVRARFPHPRQ 73 
148256563   1 MNPANLP-------FDTEAMLQGLRGWVECESPTWDAAAVERMLDLAARDMAIMGATIERIAGRQGFAGCVRARFPHPNQ 73 
161511092   1 MNPANLP-------FDSEAMLEGLRGWVECESPTWDASAVNRMLDIAARDMAIMGATIERIAGRQGFGGVIRARFPHPKQ 73 
170739202   1 MIPSGLP-------LDLDAMLATLRPWVECESPTFATPAVNRMMALAARDLAVAGARIEVVPGRMGLGDCVRARFPHPRP 73 
39934292    1 MNPANLP-------FDSDTMLQGLRAWVECESPTWDTAAVERMLDLAAREMAIMGATIERIAGRQGFAGCVRARFPHPKQ 73 
90422710    1 MNPANLP-------FDSEAMLQGLRAWVECESPTFDTAAVNRLLDLAAREMAIMGAHIERISGRQGFADCVRATFPHPKQ 73 
91978484    1 MNPANLP-------FDSEVMLQGLRAWVECESPTWDAAAVERMLDLAARDMAIMGAAIERIAGRQGFAGCVRARFPHPRQ 73 
86748350    1 MNPANLP-------FDSEAMLQGLRAWVECESPTWDKAAVERMLDLAARDMAVMGASIERIAGRQGFAGCVRARFPHPRQ 73 
192289820   1 MNPANLP-------FDSDTMLQGLRAWVECESPTWDTAAVERMLDLAAREMAIMGATIERIAGRQGFAGCVRARFPHPKQ 73 
56696108    1 MPYLDLP-------FDADAMLAGLKPWIECESPTFDAAAVNRMMSLAAYDLSQMGV-VERIPGRMGFGDSLRVRLPHPRA 72 
220921369   1 MNPTDLP-------LDREAMLASLRPWIECESPTFDPLAVNRMMALAARDLAVAGASVEVIPGRMGLGDCVRARFPHPRR 73 
170747329  81 DAPGILVLGHLDTVHPVGTLGSLPWRIEGDRAYGPGILDMKGGNVVALAAIRALAAAGIETPLPVTVLFTGDEEVGSPST 160
158423698  74 GTPGILVMGHFDTVHPIGTLEKLAFRQEGNLCWGPGLLDMKGGTFTALEALIQLTRAGIETPLPITFLFTSDEEIGSPGT 153
146339918  74 GEPGILIAGHMDTVHPVGTLAQLSWRRDGGKCYGPGICDMKGGNYLSLEAIRQLIKASVATPLPITVLFTPDEEVGTPST 153
148256563  74 GQPGILIAGHMDTVHPVGTLAKLSFRREGNKCYGPGICDMKGGNYITLEAIRQLIKASVTTPLPITVLFTPDEEVGTPST 153
161511092  74 GEPGILIAGHMDTVHLVGTIEKLKWRREGSKCYGPGICDMKGGNYLSLEAIRQLARASFTTPLPITVLFTPDEEVGTPST 153
170739202  74 ETPGILVLGHMDTVHPVGTLEVLPWRREGGRVHGPGILDMKGGNLLALEAIRALGRAGIATPLPVTVLLTGDEEIGSPST 153
39934292   74 GEPGILIAGHLDTVHPVGTLSKLPFRREGNKAFGPGIFDMKGGNYLTLEAIKQLARASFTTPLPITVLFTPDEEVGTPST 153
90422710   74 GEPGILIAGHLDTVHPIGTLRDLPFRRDGNKCFGPGIYDMKGGNYLSLEAIRQLARAAFTTPLPITVLFTPDEEVGTPST 153
91978484   74 GEPGILIAGHLDTVHPVGTLQKLQWRRDGNKCFGPGIFDMKGGNYLTLEAIRQLARASFTTPLPITVLFTPDEEVGTPST 153
86748350   74 GEPGILIAGHLDTVHPVGTIEKLQWRRDGNKCYGPGIFDMKGGNYLTLEAIRQLARASFTTPLPVTVLFTPDEEVGTPST 153
192289820  74 GEPGILIAGHLDTVHPVGTLSKLPFRREGNKAFGPGIFDMKGGNYLTLEAIKQLARASFTTPLPITVLFTPDEEVGTPST 153
56696108   73 GEPGILIAGHMDTVHPIGTLAKLPFRREGDLCYGPGIQDMKGGNYCALEALRQIAAAGLHTPLPVTVLFTPDEEVGTPST 152
220921369  74 DEPGILVLGHMDTVHPLGTLRLLPWRREGGRVYGPGILDMKGGNLLALEAIRALGRAGIRTPLPVTVLFTSDEEIGSPAT 153
170747329 161 RDLIEAEAARHAFVLVPEPGQPENGVVTGRYAIARFELEALGRPSHAGASPHEGRSAIRAMARKILAIDALSDADCTVST 240
158423698 154 RTLIEEEAKTHKYVLVPEPGLADKGVTTGRYAIARYKLTAYGRASHAGATLKEGRSAIREMARRIPEIEDMTSDDCTFSV 233
146339918 154 RDIIEAEAKRNKYVLVPEPGRPDNGVVTGRYAIARFNLEATGRPSHAGARLAAGRSAIREMARQILAIDAMTTEDCTFSV 233
148256563 154 RDIIEAEAQRNKYVLVPEPGRPDNGVVTGRYAIARFNLEAVGRPSHAGARLGAGRSAIREMARQILAIDAMTGEDCTLSV 233
161511092 154 RDIIEAEAARNKYVLVPEPGRADNGVTTGRYAIARFNLEATGRPSHAGSTLSAGRSAIREMARQILAIDAMTTEDCTFSV 233
170739202 154 RDLIEAEASRHRYVLVPEPGHEDNGVVTGRYAIARFVLEATGRPSHAGARLGEGRSAVRAFARKILAIEAMSGEDCTFSV 233
39934292  154 RDIIEAEAARNKYVLVPEPGRPDNGVVTGRYAIARFNLEAIGKPSHAGATLSSGRSAIREMAKQILAIDAMTTEDCTFSV 233
90422710  154 RDVIEAEAMRNKYVLVPEPGKPNNGVVTGRYAIARFNLEVRGKPSHAGATLSSGRSAIREMARQIIAIDEMTDDDCTFSV 233
91978484  154 RDIIEAEAARNKYVLVPEPGRPDNGVVTGRYAIARFNLTATGKPSHAGATLSSGRSAIREMARQILAIDAMTTDDCTFSV 233
86748350  154 RDIIEAEAARNKYVLVPEPGRPDNGVVTGRYAIARFNLTATGKPSHAGATLSSGRSAIREMARQILAIDAMTTEDCTFSV 233
192289820 154 RDIIEAEAARNKYVLVPEPGRPDNGVVTGRYAIARFNLEAIGKPSHAGATLSSGRSAIREMAKQILAIDAMTTEDCTFSV 233
56696108  153 RELIESEARRNRYVLVPEPALPNGGVVIGRYAIARFNLRTTGRPSHAGARLAEGRSAIAAMARRILDIEAMTGADCTFSV 232
220921369 154 RDLIEAEAARHRFVLVPEPGQEDNGVVTGRYAIARFNLEAVGRPSHAGARLGDGRSAVRAFARKVLAIEAMTGEDCTFSV 233
170747329 241 GVVSGGQWVNCVPTVCRGQALSMAKRQADLDRGVARMLALSGEEDG-VRFTVTRGVTRPVWEPD-AGCMALYERARALSE 318
158423698 234 GVVHGGQWVNCVATTCSGEALSMAKRQEDLDRGTTRILALNERREDgTGFEVKTSVVRPVWEPN-AGSMALHALAKSIAG 312
146339918 234 GIVHGGQWVNCVATTCTGEALSMAKRQADLDRGVERMLALSGTTDD-VAFKVTRGVTRPVWEPD-SGTMALYEKARSLAE 311
148256563 234 GIVHGGQWVNCVATTCTGEALSMAKRQADLDRGVERMLALSGTHDD-VSFTVTRGVTRPVWEPD-SGTMALYEHARGIAE 311
161511092 234 GVVHGGQWVNCVATIATGEALSMAKRQADLDRGVERMLALSGTTND-VAFKVTRGVTRPVWEPD-AGTMALYEKARDIAR 311
170739202 234 GIVQGGQWVNCVPTRCRGEALSMAKRQADLDRGVARMLALSGTEDD-VAFTVTRGVTRPVWEPD-AETLALYETARALAA 311
39934292  234 GIVHGGQWVNCVATTCTGEALSMAKRQADLDRGVDRMLALSGSSSD-VTFKVTRGVTRPVWEPD-SGTMALYEKARAVAS 311
90422710  234 GIVHGGQWVNCVASSCRGEALSMAKRQADLDRGVARMLALTASSPD-VTFTVTRGVTRPVWEPG-DATLALYEQARGIAA 311
91978484  234 GIVHGGQWVNCVATTCTGEALSMAKRQADLDRGVERMLALSGAGND-VGFEVTRGVTRPVWEPD-AGTMALYEKASAVAK 311
86748350  234 GIVHGGQWVNCVATTCTGEALSMAKRQADLDRGVERMLALSGTSND-VGFEVTRGVTRPVWEPD-AGTMALYQKAAAIAD 311
192289820 234 GIVHGGQWVNCVATTCTGEALSMAKRQADLDRGVDRMLALSGSSSD-VTFKVTRGVTRPVWEPD-AGTMALYEKARAVAS 311
56696108  233 GVIHAGQWVNCVSSSCEAEALSMAKRQEDLDDGIARMLALAGEADD-VLFEVTRGVTRPVWQPNqPGTMQMYDLAREIAG 311
220921369 234 GVVHGGQWVNCVPTVCRGEALSMAKRQTDLDRGVARMLALSGMEDD-VTFTVTRGVTRPVWEPD-AGTLALYETARGLAG 311
170747329 319 ALGQPLPHRSAGGGSDGNFTGANGIPTLDGLGPLGQGYHTLEEHVLIESLPRRARLFAALLASLG 383
158423698 313 ELGFDLPHRSSPGGSDGNFTGALGIPTLDSLGPCGGDYHTLNEHIRIDTLAERGRLIAGLMARLS 377
146339918 312 QLGMSLPHGSAGGGSDGNFTGALGIPTLDGLGVRGADMHTLNEYIEVDSLAERGRLMAGLLATLA 376
148256563 312 QLGLSLPHGSAGGGSDGNFTGALGIPTLDGLGVRGGDMHTLNEHIEVDSLAERGRLMAGLLATLA 376
161511092 312 SLGAELPHASSGGGSDGNFTGAMGIPTLDGLGVRGGNVHTLEEYIEVESLVERGRLMAGLLATLE 376
170739202 312 AEGLALPHRSAGGGSDGNFTGAMGIPTLDGLGAIGRGYHTLEEQIDEASLVSRARLFAGLLAMLR 376
39934292  312 QLGVSLPHGSAGGGSDGNFTGAMGIPTLDGLGVRGADAHTLNEHIEVDSLAERGRLMAGLLATLE 376
90422710  312 QLGIKLTHGSAGGGSDGNFTGAMGIATLDGLGVRGADPHTLNEHIEVDSLAERGRLMAGLLATLE 376
91978484  312 QMGMSLPHGSAGGGSDGNFTGAMGIPTLDGLGVRGADAHTLNEHIEVDSLAERGRLMAGLLATLE 376
86748350  312 QLGLKLPHGSAGGGSDGNFTGAMGIPTLDGLGVRGADAHTLNEHIEVDSLAERGRLMAGLLATLA 376
192289820 312 QLGVSLPHGSAGGGSDGNFTGAMGIPTLDGLGVRGADAHTLNEHIEVDSLAERGRLMAGLLATLE 376
56696108  312 EMGVELPCDSAGGGSDGNFTGALGIATLDSLGVRGKGLHTLTEHIEVASLPERARLMAGLLLRLE 376
220921369 312 TMGLPLPHCSAGGGSDGNFTGALGLPTLDGLGAIGRGYHTLEEHLDEESLVSRGRLFAGLLATLR 376
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap