Conserved Protein Domain Family
PRK07414

?
PRK07414: PRK07414 
P-loop NTPase family protein
Statistics
?
PSSM-Id: 168945
View PSSM: PRK07414
Aligned: 9 rows
Threshold Bit Score: 300.502
Threshold Setting Gi: 22298460
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
81299881    1 MVSQLKpsllsvVSPAKPSQPLP-TVEGLVQIFTASQRGFFTSVMSQALRLAGQGTTVLVIQFLKGGCQQGPDQPIRLGQ 79 
56750486    5 MVSQLKpsllsvVSPAKPSQPLP-TVEGLVQIFTASQRGFFTSVMSQALRLAGQGTTVLVIQFLKGGCQQGPDQPIRLGQ 83 
75908881    1 MVAQLE------TPSANSSLSLPyPIEGLVQVFTSSHRNFFTSVMGQALRIAGQGTPVLIVQFLKGGIKQGQDRPIQLGQ 74 
17227563    1 MVAQLE------TPSANSPLNLPyPIEGLVQVFTSSHRNFFTSVMGQALRIAGQGTPVLIVQFLKGGIKQGQERPIQLGQ 74 
186682827   1 MVAQLE------TQSINSTLTLPyPVEGLVQVFTSSHRNFFTSVIAQSLRIAGQGTSVLIVQFLKGGIRQGHDRPIQLGQ 74 
113475740   1 MVAQLQ------TPSLSVPSDLPyTVPGLVQVFTSGQRNFFTDVMAQALRIAGQGKTVLIVQFLKGGIKQGYKQPIQLGQ 74 
37523080    1 MVAQVDa-----SNPTSKAVAPSlALQGTLQIVTGPDRAFNAGVIAHALRAAGQGVPVLVVQFLKGGIGQGPDNPMYLCQ 75 
220910437   1 MVSQLE------VSHLNLERRAPyTIEGLTQVFTACHRGFFTSVMAQALTIAGQGTPVLVVQFLKGGINMGPERPMRLGE 74 
22298460    1 MVAQLS------VSASEASLPLTyGIEGVVQVFTCPQRHFFTTVIAQALRVAAQGSGVMIVQFLKGGIQMGVEHPIQLGQ 74 
81299881   80 NLEWVRLGVPNCL-DTPQVDESSAIALKELWRFAIAAIDSGRYELVVLDELTLAVDFGLIAEAEVVELLRHRPQHVDVIL 158
56750486   84 NLEWVRLGVPNCL-DTPQVDESSAIALKELWRFAIAAIDSGRYELVVLDELTLAVDFGLIAEAEVVELLRHRPQHVDVIL 162
75908881   75 NLDWIRCDLPRCI-DTPHLDESENQALQKLWLHTQQVVDEDKYSLVVLDELSLAIHFGLIPESDVLAFLAKRSPHVDIIF 153
17227563   75 NLDWIRCDLPRCI-DTPHLDESENQALQKLWLHTQQVVDEDKYSLVVLDELSLAIHFGLIPESDVLAFLAKRPPHVDIIF 153
186682827  75 NLDWIRCDLPRCI-DTPHLDDTENQALQKLWQYTQQVVCESKYSLVVLDELSLAINFGLIPETEVLAFLAKRPPHVDIIL 153
113475740  75 NLSWVRCDISSCI-DAPEIDENQKKSLLDLWSYTQKVVCEGKYELVVLDELSLAINFGLIPENEVLDFLEKRPSNLDVIL 153
37523080   76 GLRWVRCNLQRCL-DTPHLEIEEQKAMYELWKYTRRAVHSGRFGLVVLDELSLAIQFGLIAETEVIELLEQRPSYMDVIL 154
220910437  75 HLDWVRCNLPRCI-DTPNLEPEEMEALQELWDYTRAVVMQGRYSLVVLDELSLAIHLGLIPEVEVLNLLNDRPRHIDMIL 153
22298460   75 HLTWWRPALQRCLgQGDSITPQEKAAVRELWQHLQTKVQEGQHRLVVLDEVSVAMQLGVLTEGEVLDFLKNRPRTLDVML 154
81299881  159 TGPRVSESLLAIADQITELRRGS-RY 183
56750486  163 TGPRVSESLLAIADQITELRRGS-RY 187
75908881  154 TGTEMPQSILDVADQITEIRRSH-CP 178
17227563  154 TGTEMPQSILDVADQITEIRRSH-CP 178
186682827 154 TGPEMPKSLLDVADQITEIRRSY-RP 178
113475740 154 TGPNMPEVILDIADQITEIRRSH-RP 178
37523080  155 TGPEMPIALSAMADQVTELRKSAiQP 180
220910437 154 TGPEMPPTILDIADQITELRRSY-RP 178
22298460  155 TGPEMPESLLAIADQITELRRLI--- 177
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap