Conserved Protein Domain Family
PRK07394

?
PRK07394: PRK07394 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 168934
View PSSM: PRK07394
Aligned: 31 rows
Threshold Bit Score: 482.106
Threshold Setting Gi: 37521128
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
172038630   1 MSNTFREYLKKIGSGVHTGRDLTRSESADAMKLMLLAEATPAQIGAFLMVHRIKRPTPEELAGMLDTYAELGPKLAIDRL 80 
166363677   1 MSDTFRELLKVIGSGTHTGRNLTRPEAAMATKMMLTQEATPAQIGAFMIAHRIKRPTSDELAGMLDAYAELGPQITLESA 80 
170078226   1 MSTEFRELLKKVGSGKHTSKSLTRAEAAIALDMMLDGTATPAQIGAFLISQRIKRPTGVELAGMLDAYDRRSQKLDPLPN 80 
81299743    1 MSERFRDLIRKVGSGRHTSQVLTQAEAAEALQLMLSATATPAQIGAFLIAHRIRRPTGTELAGFLETYADWLPAVLAPST 80 
56750617    1 MSERFRDLIRKVGSGRHTSQVLTQAEAAEALQLMLSATATPAQIGAFLIAHRIRRPTGTELAGFLETYADWLPAVLAPST 80 
16330085    1 MSKEFRELLRKVGSGPHTSKNLTREESAQAMKLMLTQEATPAQIGAFLIAHRIKRPTGTELAGMLDAFEQWGPKIPALSS 80 
113477736   1 MSDRFRELLKIIGSGTHTGKNLTRQEAAAAMRMMLLGEATPTQIGAFLIAHRIKRPTGEELAGMLDTYNELGPKLKSQPS 80 
218247265   1 MSNTFREYLKKIGSGTHTGKDLTRTEAADAAKLMLLGEATPAQIGAFLIAHRIKRPTAAELAGILDTYDEVGPKIPTNDV 80 
218438655   1 MSSQFRELLKKVGSGQHTKENLTRTEAAQATGMMLMGEATAAQIGAFMIAHRIKRITPEELAGMLDAYDELSPHIYPSPE 80 
257061399   1 MSNTFREYLKKIGSGTHTGKDLTRTEAADAAKLMLLGEATPAQIGAFLIAHRIKRPTAAELAGILDTYDEVGPKIPTNDV 80 
172038630  81 AfdYPVTVLGTPYDGRSRTAPVTTLTTLILATVGVPVVLHGGQAMPTKYGVPLITLWQGLGVDFSRLSLEESQTMLEKTG 160
166363677  81 SfqHPIAIFGNPYDGRSRTAPVTPITTLILGLAGVPVVLHGGDRMPTKYGISLREIWQQLGADFSQLSLAAVKDCLITTG 160
170078226  81 G--EKVFILGIPYDGRTKTAPIAPITALILKTAGVPVLMHGGDRLPTKYGLPLGEIWQALGLDFQALSFVQLQSYFQRTH 158
81299743   81 T--RPPLVLGYPYDGRDRTAPLGPLLALLLAAVGQPVVLHGSDRVATKYGVPLVELWDAIGVNWRSRSVADLNRCLEQAG 158
56750617   81 T--RPPLVLGYPYDGRDRTAPLGPLLALLLAAVGQPVVLHGSDRVATKYGVPLVELWDAIGVNWRSRSVANLNRCLEQAG 158
16330085   81 G--QTVIVLSQPYDGRDRTCPVGPLTALVLATAGCPVIQHGGDRMPTKEGIPLVELWEGLGVNWRSPSLLATQDILEKTN 158
113477736  81 M--GTVTVLGCPYDGRSRTSPVTLLTALILATAGVFVVIHGGRRMPTKEGIPFIDIWQGLGVEWGKLSLVEVQRVFEETG 158
218247265  81 SfdYPVTVLGTPYDGRSRTVPVTPITALILATAGVPVVMHGGDRMGTKYGLPMVEIWQGLGIDFTQFSLTQVTELLAKTG 160
218438655  81 E--KTPFVFGIPYDGRSRTAPIFPLTALILSCAGVPAIMHGGDSMPTKYGIPLIELWQGLGLDFSVLAIEQVQELYNRTG 158
257061399  81 SfdYPVTVLGTPYDGRSRTVPVTPITALILATAGVPVVMHGGDRMGTKYGLPMVEIWQGLGIDFTQFSLTQVTELLAKTG 160
172038630 161 LTFVYLPNHFPEAHHLVPYREQIGKRPPLATLELMWAPCsSSDVHIVSGFVHPPTENLFRETLKLRN-FHYFTTVKGLEG 239
166363677 161 FTFFYIPRHFPLVENFVTYREQIGKRPPMATVELMWSPF-VGNIHQISGFVHPPTEDRFRETFALRN-ISHFTTVKGLEG 238
170078226 159 FACCYTPTLLPASQTLISYREELGKRPSLATLELVWSPSgDRQAHTIAGYVHPPTEAIIRDTFTERG-NPPYTLIKGLEG 237
81299743  159 VAQLHQPSLCPAAEVLNGYRSELGKRPPLATAELMLVPV-QGAALPVCGFVHPPTELMIEEALSLRG-ITTFFTIKGLEG 236
56750617  159 VAQLHQPSLCPAAEVLNGYRSELGKRPPLATAELMLVPV-QGAALPVCGFVHPPTELMIEEALSLRG-ITTFFTIKGLEG 236
16330085  159 VGFVYLPKYFPEAQKLVIYREEIGKRPPLATLELIWVPY-AGKHHVVAGFVHPPTENMIAEALSLRG-VSTFTTVKGLEG 236
113477736 159 LGFVYLPRHFPQADALVKHRRDIGKRPPIAIMELIWVPL-AGEVHLAAGYVHPPTEGMFREVLELHG-LRNYTTVKGLEG 236
218247265 161 LTFVYVPRHFPLINPVISYRNEIGKRPPLASIELIWSPC-SGDVHTMVGFVHPPTEMFFKETFELRG-VKQFTTIKGLEG 238
218438655 159 LGFIYTPRHFPLADGLTPYRDQIGKRPPIATLELIWSPY-VGNFHLVSGYVHPPTEALFRETLKLRKpTIAFTFVKGLEG 237
257061399 161 LTFVYVPRHFPLINPVISYRNEIGKRPPLASIELIWSPC-LGDVHTMVGFVHPPTEMFFKETFELRG-VKQFTTIKGLEG 238
172038630 240 SCDLPQSRTAIIGINqp-kHDPEWQRLHLHSQDYNLSSKDVPLESTEQLLKQMQQVLHGEDNPLMPLAIYNSGFYLWRCG 318
166363677 239 SCDLACNRTAIIGLGnp-tDPPSFQRFFLNPRDYGFCPSDYPLESLEMLTAKLKGLLAGENNELTDAAIFNGGFYLWRCG 317
170078226 238 SGDLRISQTTIVVTNqt-eSADGFVYLKPNPYDYGLGGEDIHLESPEQYYQDLAALLQGQPSPLTDSAVWNGGFYLWHCG 316
81299743  237 SPELPRDRAAIVGRW----QNGHCDRLILHARDWDLGEAELPWMGEDAWVEAAQALLEGQPSVLEPLLRWNGAAYLWFLG 312
56750617  237 SPELPRDRAAIVGRW----QNGHCDRLILHARDWDLGEAELPWMGEDAWVEAAQALLEGQPSVLEPLLRWNGAAYLWFLG 312
16330085  237 SCDLPQERTAIIGLYdltkAENALTRLRLHAADFGLGGKNPVWTNLVDYLELAQATLNGEQTPLRSALIWNSAFYLWQHT 316
113477736 237 SCDLPRDRTAIIGVSlssgNDATFERLLLHPSDYSCGGKEVVLGSTAELVEEIQKILQGKASKLMSAVIWNGAFYLWRCG 316
218247265 239 SCDLPLSRTAIIGLAep-dLKLPWERLLLHPKDYGFGNKDIALDSETKVIEQLQGIINGESNELISSVIYNGGFYLWRCG 317
218438655 238 SCDIRLSQTTIVAISqp-qTSEGFEYLKLHPQDYGMEGKDHPLDSTSDLFLAMDAVIEGKASPLKQASIWNGGFYLWRYG 316
257061399 239 SCDLPLSRTAIIGLAep-dLKLPWERLLLHPKDYGFGNKDIALDSETKVIEQLQGIINGESNELISSVIYNGGFYLWRCG 317
172038630 319 VCDNLNVAFDQAKTLLTSGRVKQKLQDISK 348
166363677 318 IAPDIPTAFQQAQQCLQSGKALAKLQQICN 347
170078226 317 QVKDLQSGLDLAQTWVKTGKLQATLTALKA 346
81299743  313 MASSMTAGLVQVDHLLQTKALLQQRDRLQQ 342
56750617  313 MASSMTAGLVQVDHLLQTKALLQQRDRLQQ 342
16330085  317 DAPNLETAIAKAEKLIDDGLVKQQWHRLQL 346
113477736 317 ICSDINEGLLKAESLLNSGKVRDKLREIKA 346
218247265 318 VCADLKTGFEQAETLLNDQKVSLKLQEIIN 347
218438655 317 ICPDFSSGLEIAENLLNSGKVAQKRAEIRA 346
257061399 318 VCADLKTGFEQAETLLNDQKVSLKLQEIIN 347
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap