Conserved Protein Domain Family
PRK07248

?
PRK07248: PRK07248 
chorismate mutase
Statistics
?
PSSM-Id: 168880
View PSSM: PRK07248
Aligned: 44 rows
Threshold Bit Score: 115.545
Threshold Setting Gi: 125625237
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
125718087  1 MTLEEIRQEIDQVDDAIVTLLEQRMNLVDQVVALKKLTGTAVLDSKREDVIFARVADKVENKDYKETVVATFSDILKRSR 80 
22536718   1 MELEEIRQEIDEIDQQLVSLLETRMGLILEVIAFKKKHRLPVLDNNRENEVLNNVLKKVQNHQFDDVIRATFKDIMTESR 80 
25010654   1 MELEEIRQEIDEIDQQLVSLLETRMGLILEVIAFKKKHRLPVLDNNRENEVLNNVLKKVQNHQFDDVIRATFKDIMTESR 80 
28896295   1 MRLEEIRQEINSIDHHLVALLEKRMALVEQVTAYKLANHLPVLDQVRENQILDRVSYLVKDQAFEPAIHETFKTIMSLSR 80 
21910008   1 MRLEEIRQEINSIDHHLVALLEKRMALVEQVTAYKLANHLPVLDQVRENQILDRVSYLVKDQAFEPAIHETFKTIMSLSR 80 
139474078  1 MRLEEIRQEINSIDHHLVALLEKRMALVEQVTAYKLANHLPVLDQARENQILDRVSYLVKDQAFEPAIHETFKTIMSLSR 80 
71903193   1 MRLEEIRQEINGIDHHLVALLEKRMALVEQVTAYKLANHLPVLDQARENQILDRVSYLVKDQAFEPAIHETFKTIMSLSR 80 
94988233   1 MRLEEIRQEINGIDHHLVALLEKRMALVEQVTAYKLANHLPVLDQARENQILDRVSYLVKDQAFEPAIHETFKTIMSLSR 80 
94992107   1 MRLEEIRQEINGIDHHLVALLEKRMALVEQVTAYKLANHLPVLDQARENQILDRVSYLVKDQAFEPAIHETFKTIMSLSR 80 
94990115   1 MRLEEIRQEINSIDHHLVALLEKRMALVEQVTAYKLANHLPVLDQVRENQILDRVSYLVKDQAFEPAIHETFKTIMSLSR 80 
125718087 81 EFQNKNI 87 
22536718  81 VYQKENI 87 
25010654  81 VYQKENI 87 
28896295  81 KYQTQHL 87 
21910008  81 KYQTQHL 87 
139474078 81 QYQTQHL 87 
71903193  81 QYQTQRL 87 
94988233  81 QYQTQRL 87 
94992107  81 QYQTQRL 87 
94990115  81 KYQTQHL 87 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap