Conserved Protein Domain Family
flgB

?
PRK07182: flgB 
flagellar basal body rod protein FlgB; Reviewed
Links
?
Statistics
?
PSSM-Id: 75964
View PSSM: PRK07182
Aligned: 11 rows
Threshold Bit Score: 234.393
Threshold Setting Gi: 108809058
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
170022968   1 MGIHFQKALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLSTqmsstqms 80 
22127331    1 MGIHFQKALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 72 
218927909   1 MGIHFQKALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 72 
45442793    1 MGIHFQKALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 72 
162418530   1 MGIHFQKALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 72 
108809058   1 -------------MAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 59 
108810745   1 -------------MAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 59 
145597814   1 -------------MAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 59 
294502785   1 MGIHFQKALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 72 
51597640    1 MGIHFQKALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 72 
186896774   1 MGIHFQKALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 72 
170022968  81 saQMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 158
22127331   73 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 148
218927909  73 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 148
45442793   73 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 148
162418530  73 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 148
108809058  60 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 135
108810745  60 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 135
145597814  60 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 135
294502785  73 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 148
51597640   73 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 148
186896774  73 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap