Conserved Protein Domain Family
PRK07122

?
PRK07122: PRK07122 
RNA polymerase sigma factor SigF; Reviewed
Statistics
?
PSSM-Id: 168831
View PSSM: PRK07122
Aligned: 27 rows
Threshold Bit Score: 428.81
Threshold Setting Gi: 108799863
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118465934   4 AIAPTPTAARPTTq---SDDSYEDVVEMFLELRRMPAESHEYRRQRERIVARCLPLADHVASHFARRGEGLDDLVQVARL 80 
108799863   5 DDTLQVTAKRPSTr---TQDDYTDVPDMFRLLSVLSPGTPDHDRQRERIVTRCLPLADHIAFRYHRKGENLDDLVQIARV 81 
126435506   5 DDTLQVTAKRPSTr---TQDDYTDVPDMFRLLSVLSPGTPDHDRQRERIVTRCLPLADHIAFRYHRKGENLDDLVQIARV 81 
41407572    4 AIAPTPTAARPTSq---SDDSYEDVVEMFLELRRMPAESHEYRRQRERIVARCLPLADHVASHFARRGEGLDDLVQVARL 80 
118470482   1 -----------------MTSEYADVLDMFRELAGTTEGSPSYVRQREKIVERCLPLADHIARRFDGRGEPREDLVQVARV 63 
145225367   1 MTRSSSQGSSRSN------SEYSDVADMFRELAELEEGSAAFQRQRDRIVERCLPLADHIARRFDGRGEPRDDLVQVARV 74 
226305067   1 MTASADGPSRPRRr---STDEYRDVIPVFEEMRTLEPHSPEYERVRTALITRCLPLAEHIARRFDGRGEAHDDLVQVARL 77 
169629597   5 VDVPETGHSQVKPrvgrPTDDYADVPDMFRSLAGLAEHSDAYQRKHEEIVTRCLPLADNVARHFDRRGEDLEDLIQVARV 84 
226361251   1 MTSHTHSGGHTAR----WPDEYQDVTALFRQMAALDEDDPRRSRLRDAVVTRCLPLAEHIARRFDGRGEAHDDLVQVARL 76 
120402666   1 MTRSSSQGSSSRS-----GSEYADVAPMFRELAELEEGTAAFQRQRDRIVERCLPLADHIARRFDGRGEPRDDLVQVARV 75 
118465934  81 GLMNAVNRFDPAKGPSFIGFAVPTMMGEVRRYFRDYSWGMRVPRRLRELHVQISRTTADLAQQLGRAPNAGELSQVLEVP 160
108799863  82 GLMHAVNRFDPENGANFLSFAVPTMLGEIRRHFRDNGWAMHVPRRLKDLHVQITRATPRLTQSLGRPPTPTDLAAELGAD 161
126435506  82 GLMHAVNRFDPENGANFLSFAVPTMLGEIRRHFRDNGWAMHVPRRLKDLHVQITRATPRLTQSLGRPPTPTDLAAELGAD 161
41407572   81 GLMNAVNRFDPAKGPSFIGFAVPTMMGEVRRYFRDYSWGMRVPRRLRELHVQISRTTADLAQQLGRAPNAGELSQVLEVP 160
118470482  64 GLVNAVNRFDVEAGSDFVSFAVPTIMGEVRRHFRDNSWSVKVPRRLKELHLRLGAATAELSQRLGRAPTASELAHELDMD 143
145225367  75 GLVNAVIRFDVTAGSDFVSFAVPTIMGEVRRHFRDNSWSVKVPRRLKELHLRLGAATAELSQRLGRAPTPSELAAELEMD 154
226305067  78 GLVNAVDRFDSTRGSDFVSFAVPTVMGEVRRHFRDTGWALRVPRRMKELHFQLGQAISELSQQLGHAPTVDELAETLGIE 157
169629597  85 GLLNAVNRFDPEKGASFLGFAVPTMMGEVRRHFRDHGWSLHVPRAIRDRHAQISRATAELTQELQRAPTAGELAAELGID 164
226361251  77 GLVNSVDRFDVERGSDFVSFAVPTIMGEVRRHFRDTGWAVRVPRRMKELHLALSQAVAELSQSLGHAPTVSELAEHLDLE 156
120402666  76 GLVNAVIRFDVNAGSDFVSFAVPTIMGEVRRHFRDNSWSVKVPRRLKELHLRLGAATAELSQRLGRAPTATELAAELEMD 155
118465934 161 REEIVECLVAGDAYRLDSLDAPQGADSSGTpRSVADSVGDIDPQIEHITNREALRVLVATLPHREREVLRMRFFESMTQS 240
108799863 162 RQEVVECLVAGDAYSLRSIDSPISSSDDTT-RSLADTLGEVDGEMEHITDRESLRPLLAALTERERTVISLRFFASMTQT 240
126435506 162 RQEVVECLVAGDAYSLRSIDSPISSSDDTT-RSLADTLGEVDGEMEHITDRESLRPLLAALTERERTVISLRFFASMTQT 240
41407572  161 REEIVECLVAGDAYRLDSLDAPQGADSSGTpRSVADSVGDIDPQIEHITNREALRVLVATLPHREREVLRMRFFESMTQS 240
118470482 144 REEVVEGLIAGSSYNTLSIDSGGGG-DEEA-PAIVDTLGDLDMGLDQIDNRESLRPLLASLPERERTVLVLRFFESMTQT 221
145225367 155 RDEVVEGLVAGSSYNTLSIDSGGGSGNEDA-PAIADTLGDVDLTLDQIENREALRPLLAALPERERTVLVLRFFESMTQT 233
226305067 158 REEVAQALIAGNAYQTVSVDGAASN-HTDD-LPLVETLGDYDAALENVENHEALRPLLDKLPERERTVLMLRFFGNLTQT 235
169629597 165 REEVVESLIAADAYQPQSIEAPLSHGDQES-KHLSDLLGNEDPALEHVTNREAVRPLLANLPLRERTVLELRFFKGMTQS 243
226361251 157 QEEVAQGLLAGNAYQTVSVDNTSSD-RAGE-LSMVETLGDYDAAMDDVENHETLRPLLQSLPERERTVLMLRFFGNMTQT 234
120402666 156 RDEVVEGLVAGSSYNTLSIDS-GGSGNEDA-PAIADTLGDVDLSLDQIENREALRPLLAALPERERTVLALRFFESMTQT 233
118465934 241 QIAERIGVSQMQVSRILANTLRCLRDQLE 269
108799863 241 QIAERIGVSQMQVSRILAKTLQQLRDGMS 269
126435506 241 QIAERIGVSQMQVSRILAKTLQQLRDGMS 269
41407572  241 QIAERIGVSQMQVSRILANTLRCLRDQLE 269
118470482 222 QIAERVGISQMHVSRLLAKSLARLRDQLQ 250
145225367 234 QIAERVGISQMHVSRLLAKSLTRLRDQLE 262
226305067 236 QIAEKVGVSQMHVSRLLAKTLSNLREQLD 264
169629597 244 QIAAQIGVSQMHVSRILSDTLRYLREQMA 272
226361251 235 QIADRVGISQMHVSRLLAKTLASLRDQLG 263
120402666 234 QIAERVGISQMHVSRLLAKSLARLRDQLE 262
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap