Conserved Protein Domain Family
PRK07075

?
PRK07075: PRK07075 
isochorismate lyase
Statistics
?
PSSM-Id: 136191
View PSSM: PRK07075
Aligned: 23 rows
Threshold Bit Score: 157.587
Threshold Setting Gi: 70733858
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116052267   1 MKTPEDCTGLADIREAIDQIDLDIVQALGRRMDYVKAASRFKANEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFA 80 
152984038   2 MKMPEDYTGLADIREAIDRIDHDIVLALGRRMDYVKAASRFKASEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFA 81 
218889441   1 MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFA 80 
70730851   16 MKTPEQCSGLDDVRCGIDAMDQQIIQALGRRLAYVKAAAQFKPTEDSIAAPERVAAMLPQRRQWAEQASLDPMFVVPLFA 95 
70733858    6 QMSPEQCQGMDDIRREIDALDRAVIALLGARFQYVLAASKFKTSAATVRAEERFKAMLATRRDWAAAEGLNPDAIEKMYS 85 
71733475    4 VKSAPECENLGDIRQGIDELDRQIVQILARRLTYVKAATRFKVSQQAIPAPERVRAMLEERRQWAGDAGLPVDETEDFFK 83 
28869786    4 VKSAPECENLGDIRQGIDELDRQIVQILARRLTYVKAATRFKASQQAIPAPDRVRAMLEERRQWANDAGLPVDETEDFFK 83 
104781615   4 PKTPEACTSLTDIRAGIDFHDRQIFEALVKRLGYVKAAVQFKANEQAIPAPERVAAMLQDRLEWAASEGFDAQFIEQLYT 83 
37676965    4 LKKPEACESLNDIRLGIDTLDKEIVHILSQRMGYVKAAAQFKPDEKSIPAPERVASMLEERRHWANEQGLSEEYVEALFD 83 
27367245    4 LKKPEACESLNDIRLGIDTLDKEIVHILSQRMGYVKAAAQFKPDEKSIPAPERVASMLEERRHWANEQGLSEEYVEALFD 83 
116052267  81 QIIHWYIAEQIKYWRQTRGAA 101
152984038  82 QIIHWYIAEQIKYWRQTRGAA 102
218889441  81 QIIHWYIAEQIKYWRQTRGAA 101
70730851   96 QIIHWNIAQQVRHWRRQHGLD 116
70733858   86 DLVQHFIAEEMKHWQAAQAPS 106
71733475   84 DLIHWFINQQITHWRMLHPED 104
28869786   84 DLIHWFINQQITHWRALHPEA 104
104781615  84 LIIHWNIDQQIQHWRSIHGEK 104
37676965   84 NIIQWYISQQIQHWRSQKGLA 104
27367245   84 NIIQWYISQQIQHWRSQKGLA 104
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap