Conserved Protein Domain Family
PRK07066

?
PRK07066: PRK07066 
L-carnitine dehydrogenase
Statistics
?
PSSM-Id: 168796
View PSSM: PRK07066
Aligned: 38 rows
Threshold Bit Score: 634.952
Threshold Setting Gi: 83716574
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116053533   1 MSFVTEIKTFAALGSGVIGSGWIARALAHGLDVVAWDPAPGAEAALRARVANAWPALRKQGLAPGAAQERLRFVASIEEC 80 
77461453    1 MSFITEIKTFAALGSGVIGSGWVARALAHGLDVVAWDPAPGAEAALRKRVANAWGALEKNGLAPGASQDRLRFVATIEEC 80 
229593049   1 MSFITEIKTFAALGSGVIGSGWVARALAHGLDVVAWDPAPGAEAALRKRVANAWGALEKQGLAPGASQDRLRFVATIEAC 80 
70733039    1 MTFITDIKTFAALGSGVIGSGWVARALAHGLDVVAWDPAPGAEAALRKRVANAWGALEKQGLAPGASQQRLRFVDTIEEC 80 
146305538   1 MTFVTDIKTFAALGTGVIGAGWIARALAHGLDVIAWDPAPGAEAALRTRLANAWPALQKQGLAPGASLERLRFVDTIEDC 80 
167031344   1 MPFITEIKTFAALGSGVIGSGWVARALAHGLDVVAWDPAPGAEQALRKRIANAWPALEKQGLAPGASQDRLRFVATIDEC 80 
26987044    1 MPFITEIKTFAALGSGVIGSGWVARALAHGLDVVAWDPAPGAEQALRKRVANAWPALEKQGLAPGASQDRLKFVATIEEC 80 
148545577   1 MPFITEIKTFAALGSGVIGSGWVARALAHGLDVVAWDPAPGAEQALRKRVANAWPALEKQGLALGASQDRLKFVATIEEC 80 
170724063   1 MPFITEIKTFAALGSGVIGSGWVARALAHGLDVVAWDPAPGAEQALRKRIANAWPALEKQGLAPGAAQDRLKFVATIEEC 80 
66046149    1 MSFITEIKTFAALGSGVIGSGWVSRALAHGLDVVAWDPAPGAEAALRNRVAKCWGALEQQGLVPGASQNRLRFVATVEEC 80 
116053533  81 VGDADFIQESAPERLDLKLDLHARISAAARPDVLIGSSTSGLLPSEFYAEASHPERCLVGHPFNPVYLLPLVEVVGGERT 160
77461453   81 VRDADFIQESAPERLELKLDLHSKISAAAKPNALIGSSTSGLLPSEFYESSTHPERCVVGHPFNPVYLLPLVEVVGGKNT 160
229593049  81 VKDADFIQESAPERLELKLDLHSQISAAAKPNALIGSSTSGLLPSEFYEGSTHPERCVVGHPFNPVYLLPLVEVVGGKHT 160
70733039   81 VKDADFIQESAPERLELKLELHSRISAAAKPEALIGSSTSGLLPSEFYEGSTHPERCVVGHPFNPVYLLPLVEVVGGKRT 160
146305538  81 VRDADFIQESAPERLELKCELHAKISAAARPDVLIGSSTSGLLPSEFYADAKHPERCLVGHPFNPVYLLPLVEVVGGAKT 160
167031344  81 VRNADFIQESAPERLDLKLDLHAKISAAAKPDAIIGSSTSGLLPSEFYESSTHPERCVVGHPFNPVYLLPLVEIVGGNRT 160
26987044   81 VRNADFIQESAPERLDLKLDLHAKISAAAKPDAIIGSSTSGLLPSEFYESSTHPERCVVGHPFNPVYLLPLVEIVGGSRT 160
148545577  81 VRNADFIQESAPERLDLKLDLHAKISAAAKPDAIIGSSTSGLLPSEFYESSTHPERCVVGHPFNPVYLLPLVEIVGGSRT 160
170724063  81 VRDADFIQESAPERLDLKLDLHAKVSAAAKPDAIIGSSTSGLLPSEFYESATHPERCVVGHPFNPVYLLPLVEIVGGNRT 160
66046149   81 VRDADFIQESAPERLELKLDLHSRISAAARSNVLIGSSTSGLLPSDVYESSAHPERCVVGHPFNPVYLLPLVEVVGGKNT 160
116053533 161 AAEAVRAAMRVYESLGMRPLHVRKEVPGFIADRLLEALWREALHLVNDGVATTGEIDDAIRFGAGLRWSFMGTFLTYTLA 240
77461453  161 APEAVQAAMKVYESLGMRPLHVRKEVPGFIADRLLEALWREALHLVNDGVATTGEIDDAIRFGAGLRWSFMGTFLTYTLA 240
229593049 161 APEAIQAAIKVYESLGMRPLHVRKEVPGFIADRLLEALWREALHLVNDGVATTGEIDDAIRFGAGLRWSFMGTFLTYTLA 240
70733039  161 APEAVQAAIKVYESLGMRALHVRKEVPGFIADRLLEALWREALHLVNDGVATTGEIDDAIRFGAGLRWSFMGTFLTYTLA 240
146305538 161 APEAVQAAIEVYQSLGMRPLHVRKEVPGFIADRLLEALWREALHLVNDGVASTGEIDDAIRFGAGLRWSFMGSFLTYTLA 240
167031344 161 SPEAIEAAKTIYTTLGMRPLHVRKEVPGFIADRLLEALWREALHLVNDGVATTGEIDDAIRFGAGLRWSFMGTFLTYTLA 240
26987044  161 SPEAIEAAKTIYTALGMRPLHVRKEVPGFIADRLLEALWREALHLVNDGVATTGEIDDAIRFGAGLRWSFMGTFLTYTLA 240
148545577 161 SPEAIEAAKTIYTALGMRPLHVRKEVPGFIADRLLEALWREALHLVNDGVATTGEIDDAIRFGAGLRWSFMGTFLTYTLA 240
170724063 161 APEAIEAAKTIYTALGMRPLHVRKEVPGFIADRLLEALWREALHLVNDGVATTGEIDDAIRFGAGLRWSFMGTFLTYTLA 240
66046149  161 APAAIQAAIKVYESLGMRPLHVRKEVPGFIADRLLEALWREALHLVNDGVATTGEIDDAIRFGAGLRWSFMGTFLTYTLA 240
116053533 241 GGNAGMRHFMAQFGPALQLPWTYLPAPELTEALIDRVVEGTAEQQGARSIAELERYRDDCLLAVLGAIRETKARHGFAFA 320
77461453  241 GGDAGMRHFMSQFGPALQLPWTYLPAPELTDKLIDDVVDGTSDQLGRHSISALERYRDDCLLAVLEAVKTTKEKHGMSFS 320
229593049 241 GGDAGMRHFMAQFGPALQLPWTYLPAPELTDKLIDDVVDGTSDQLGKHSISALERYRDDCLLAVLEAVKTTKAKHGMNFA 320
70733039  241 GGDAGMRHFMAQFGPALQLPWTYLPAPDLTDKLIDDVVEGTAEQLGTHSIAALERYRDDCLLAVLEAVKTTKAKHGMHFH 320
146305538 241 GGPAGMRHFMAQFGPALKLPWTYLEAPELTEGLIDAVVEGTAEQQGERSLDALERYRDDCLLAVLEAIRQTKAKHGFEFA 320
167031344 241 GGDAGMRHFMSQFGPALKLPWTYLPAPELTDQLIDDVVDGTSEQLGERSIAALERYRDDTLLAVLEAVKTSKAKHGMAFG 320
26987044  241 GGDAGMRHFMSQFGPALKLPWTYLPAPELTDKLIDDVVSGTSEQQGERSIAALERYRDDTLLAVLEAVKSSKASHGLSFS 320
148545577 241 GGDAGMRHFMSQFGPALKLPWTYLPAPELTDKLIDDVVSGTSEQQGERSIAALERYRDDTLLAVLEAVKTSKASHGLSFS 320
170724063 241 GGDAGMRHFMSQFGPALKLPWTYLPAPELTDKLIDDVVAGTAEQLGERSIAALERYRDDTLLAVLEAVKTSKASHGMSFS 320
66046149  241 GGEAGMRHFMTQFGPALQLPWTYLPAPELTDKLIDDVVDGTTDQLGKHSISGLERYRDDCLLAVLEAVKTTKARHGMA-- 318
116053533 321 E 321
77461453  321 E 321
229593049 321 E 321
70733039  321 D 321
146305538 321 E 321
167031344 321 D 321
26987044  321 D 321
148545577 321 D 321
170724063 321 D 321
66046149      -    
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap