Conserved Protein Domain Family
PRK07045

?
PRK07045: PRK07045 
putative monooxygenase; Reviewed
Statistics
?
PSSM-Id: 136171
View PSSM: PRK07045
Aligned: 12 rows
Threshold Bit Score: 640.801
Threshold Setting Gi: 152985567
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116052232   1 MTDNHIDVLINGCGIGGAMLAYLLGRQGHRVVVVEQARRERAINGADLLKPAGIRVVEAAGLLAEVTRRGGRVRHELEVY 80 
15599385    1 MTDNHIDVLINGCGIGGAMLAYLLGRQGHRVVVVEQARRERAINGADLLKPAGIRVVEAAGLLAEVTRRGGRVRHELEVY 80 
152985567   1 MTDNHIDVLINGCGIGGAMLAYLLGRQGHRVVVVEQARRERAINGADLLKPAGIRVVEAAGLLAEVTRRGGRVRHELEVY 80 
218889481   1 MTDNHIDVLINGCGIGGAMLAYLLGRQGHRVVVVEQARRERAINGADLLKPAGIRVVEAAGLLAEVTRRGGRVRHELEVY 80 
161579038   1 MKNNPVDVLINGSGIAGVALAHLLGARGHSVTVIERAARNRAQNGADLLKPSGIGVVRAMGLLDDVFAAGGLRRDAMRLY 80 
126447065   1 MKNNPVDVLINGSGIAGVALAHLLGARGHSVTVIERAARNRAQNGADLLKPSGIGVVRAMGLLDDVFAAGGLRRDAMRLY 80 
124381862   1 MKNNPVDVLINGSGIAGVALAHLLGARGHSVTVIERAARNRAQNGADLLKPSGIGVVRAMGLLDDVFAAGGLRRDAMRLY 80 
53721855    1 MKNNPVDVLINGSGIAGVALAHLLGARGHSVTVIERAARNRAQNGADLLKPSGIGVVRAMGLLDDVFAAGGLRRDAMRLY 80 
162210113   1 MKNNPVDVLINGSGIAGVALAHLLGARGHSVTVIERAARNRAQNGADLLKPSGIGVVRAMGLLDDVFAAGGLRRDAMRLY 80 
126444640   1 MKNNPVDVLINGSGIAGVALAHLLGARGHSVTVIERAARNRAQNGADLLKPSGIGVVRAMGLLDDVFAAGGLRRDAMRLY 80 
126458163   1 MKNNPVDVLINGSGIAGVALAHLLGARGHSVTVIERAARNRAQNGADLLKPSGIGVVRAMGLLDDVFAAGGLRRDAMRLY 80 
83717041    1 MKNNQVDVLINGSGIAGVALAHLLGTRGHGVTVVERAACHRAQNGADLLKPSGIGVVRKMGLLDDVIAAGGLRRDAMKLF 80 
116052232  81 HDGELLRYFNYSSVDARGYFILMPCESLRRLVLEKIDGEATVEMLFETRIEAVQRDERHAIDQVRLNDGRVLRPRVVVGA 160
15599385   81 HDGELLRYFNYSSVDARGYFILMPCESLRRLVLEKIDGEATVEMLFETRIEAVQRDERHAIDQVRLNDGRVLRPRVVVGA 160
152985567  81 HDGELLRHFNYSSVDPRGYFILMPCESLRRLVLEKIDGEATVEMLFETRIEAVQRDERHAVGQVRLNDGRVLRPRVVVGA 160
218889481  81 HDGELLRYFNYSSVDARGYFILMPCESLRRLVLEKIDGEATVEMLFETRIEAVQRDERHAIDQVRLNDGRVLRPRVVVGA 160
161579038  81 HDKAPIASLDYRSASALGYFILIPCEQLRRLLLAKLDGLPNVRLRFETSIERIERDADGTVTSLTLSDGERVAPTVLVGA 160
126447065  81 HDKAPIASLDYRSASALGYFILIPCEQLRRLLLAKLDGLPNVRLRFETSIERIERDADGTVTSLTLSDGERVAPTVLVGA 160
124381862  81 HDKAPIASLDYRSASALGYFILIPCEQLRRLLLAKLDGLPNVRLRFETSIERIERDADGTVTSLTLSDGERVAPTVLVGA 160
53721855   81 HDKAPIASLDYRSASALGYFILIPCEQLRRLLLAKLDGLPNVRLRFETSIERIERDADGTVTSLTLSDGERVAPTVLVGA 160
162210113  81 HDKAPIASLDYRSASALGYFILIPCEQLRRLLLAKLDGLPNVRLRFETSIERIERDADGTVTSLTLSDGERVAPTVLVGA 160
126444640  81 HDKAPIASLDYRSASALGYFILIPCEQLRRLLLAKLDGLPNVRLRFETSIERIERDADGTVTSLTLSDGERVTPTVLVGA 160
126458163  81 HDKAPIASLDYRSASALGYFILIPCEQLRRLLLAKLDGLPNVRLRFETSIERIERDADGTVTSLTLSDGERVAPTVLVGA 160
83717041   81 HDKELIASLDYRTSSALGFFILIPCEQLRRLLLAKLDVMPNVRLRFETSIERIEQDADGTVTSVVLSDGETVAPKALVGA 160
116052232 161 DGIASYVRRRLLDIEVERHPYPSPMLVGTFALAPCVAERNRLYVDAQGGLAYFYPIGFDRARLVVSFPREESRELMADTR 240
15599385  161 DGIASYVRRRLLDIDVERRPYPSPMLVGTFALAPCVAERNRLYVDSQGGLAYFYPIGFDRARLVVSFPREEARELMADTR 240
152985567 161 DGIASYVRRRLLDIEVERHPYPSPMLVGTFALAPCVAERNRLYVDSRGGLAYFYPIGFDRARLVVSFPREESRELMADTR 240
218889481 161 DGIASYVRRRLLDIDVERRPYPSPMLVGTFALAPCVAERNRLYVDSQGGLAYFYPIGFDRARLVVSFPREEARELMADTR 240
161579038 161 DGARSMIRDDVLRMPAERVPYATPMAFGTIALTDSVRECNRLYVDSNQGLAYFYPIGDQATRLVVSFPADEMQGYLADAT 240
126447065 161 DGARSMIRDDVLRMPAERVPYATPMAFGTIALTDSVRECNRLYVDSNQGLAYFYPIGDQATRLVVSFPADEMQGYLADAT 240
124381862 161 DGARSMIRDDVLRMPAERVPYATPMAFGTIALTDSVRECNRLYVDSNQGLAYFYPIGDQATRLVVSFPADEMQGYLADAT 240
53721855  161 DGARSMIRDDVLRMPAERVPYATPMAFGTIALTDSVRECNRLYVDSNQGLAYFYPIGDQATRLVVSFPADEMQGYLADTT 240
162210113 161 DGARSMIRDDVLRMPAERVPYATPMAFGTIALTDSVRECNRLYVDSNQGLAYFYPIGDQATRLVVSFPADEMQGYLADTT 240
126444640 161 DGARSMIRDDVLRMPAERVPYATPMAFGTIALTDSVRECNRLYVDSNQGLAYFYPIGDQATRLVVSFPADEMQGYLADTT 240
126458163 161 DGARSMIRDDVLRMPAERVPYATPMAFGTIALTDSVRECNRLYVDSNQGLAYFYPIGDQATRLVVSFPADEMQGYLADTT 240
83717041  161 DGARSMIRSDVLRVPAERVPYATPMAFGTIALTDSVRECNRLYVDSNQGLAYFYPIGDEATRLVVSFPADDMQDYLADAT 240
116052232 241 GESLRRRLQRFVGDESAEAIAAVTGTSRFKGIPIGYLNLDRYWADNVAMLGDAIHNVHPITGQGMNLAIEDASALADALD 320
15599385  241 GESLRRRLQRFVGDESAEAIAAVTGTSRFKGIPIGYLNLDRYWADNVAMLGDAIHNVHPITGQGMNLAIEDASALADALD 320
152985567 241 GESLRRRLQRFVGDESAEAIAAVTGTSRFKGIPIGYLNLDRYWAGNVAMLGDAIHNVHPITGQGMNLAIEDASALADALD 320
218889481 241 GESLRRRLQRFVGDESAEAIAAVTGTSRFKGIPIGYLNLDRYWADNVAMLGDAIHNVHPITGQGMNLAIEDASALADALD 320
161579038 241 RTKLLARLNEFVGDESADAMAAIGAGTAFPLIPLGRMNLDRYHKRNAVLLGDAAHSIHPITGQGMNLAIEDAGELGACLD 320
126447065 241 RTKLLARLNEFVGDESADAMAAIGAGTAFPLIPLGRMNLDRYHKRNAVLLGDAAHSIHPITGQGMNLAIEDAGELGACLD 320
124381862 241 RTKLLARLNEFVGDESADAMAAIGAGTAFPLIPLGRMNLDRYHKRNAVLLGDAAHSIHPITGQGMNLAIEDAGELGACLD 320
53721855  241 RTKLLARLNEFVGDESADAMAAIGAGTAFPLIPLGRMNLDRYHKRNAVLLGDAAHSIHPITGQGMNLAIEDAGELGACLD 320
162210113 241 RTKLLARLNEFVGDESADAMAAIGAGTAFPLIPLGRMNLDRYHKRNAVLLGDAAHSIHPITGQGMNLAIEDAGELGACLD 320
126444640 241 RTKLLARLNEFVGDESADAMAAIGAGTAFPLIPLGRMNLDRYHKRNAVLLGDAAHSIHPITGQGMNLAIEDAGELGACLD 320
126458163 241 RTKLLARLNEFVGDESADAMAAIGAGTAFPLIPLGRMNLDRYHKRNAVLLGDAAHSIHPITGQGMNLAIEDAGELGACLD 320
83717041  241 RAKLVARLSEFVGDESADAMAAIGAGTEFPLIPLGRMNLDRYHKRNVVVLGDAAHSIHPITGQGMNLAIEDAGELGECLD 320
116052232 321 LALRDACALEDALAGYQAERFPVNQAIVSYGHALATSLEDRQRFAGVFDTALQGSSRTPEALGGERSY 388
15599385  321 LALRDACALEDALAGYQAERFPVNQAIVSYGHALATSLEDRQRFAGVFDTALQGSSRTPEALGGERSY 388
152985567 321 LALRDACALEEALAGYQAERFPVNQAIVSYGHALATSLEDRQRFAGVFDTALQGSSRAPEALGGERSY 388
218889481 321 LALRDACALEDALAGYQAERFPVNQAIVSYGHALATSLEDRQRFAGVFDTALQGSSRTPEALGGERSY 388
161579038 321 LHLSGQITLADALERFERIRRPVNEAVISYGHTLATTYHDRAALVANFRSQLQTSGRDAAWLGAAVEV 388
126447065 321 LHLSGQITLADALERFERIRRPVNEAVISYGHTLATTYHDRAALVANFRSQLQTSGRDAAWLGAAVEV 388
124381862 321 LHLSGQITLADALERFERIRRPVNEAVISYGHTLATTYHDRAALVANFRSQLQTSGRDAAWLGAAVEV 388
53721855  321 LHLSGQITLADALERFERIRRPVNEAVISYGHTLATTYHDRAALVANFRSQLQTSGRDAAWLGAAVEV 388
162210113 321 LHLSGQITLADALERFERIRRPVNEAVISYGHTLATTYHDRAALVANFRSQLQTSGRDAAWLGAAVEV 388
126444640 321 LHLSGQITLADALERFERIRRPVNEAVISYGHTLATTYHDRAALVANFRSQLQTSGRDAAWLGAAVEV 388
126458163 321 LHLSGQITLADALERFERIRRPVNEAVISYGHTLATTYHDRAALVANFRSQLQTSGRDAAWLGAAVEV 388
83717041  321 QHLSGRIALADALDRFERIRHPVNEAVISYGHALATTYHDRAALVANFRSQLQTSGRDAALLGTAAEA 388
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap