Conserved Protein Domain Family
PRK07034

?
PRK07034: PRK07034 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 168775
View PSSM: PRK07034
Aligned: 12 rows
Threshold Bit Score: 1111.01
Threshold Setting Gi: 145600375
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22127533   10 MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEGLADQAASGNNMARTSAPPV 89 
218927713   1 MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEGLADQAASGNNMARTSAPPV 80 
162418688   1 MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEGLADQAASGNNMARTSAPPV 80 
145600375   1 MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEGLADQAASGNNMARTSAPPV 80 
294502609   1 MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEGLADQAASGNNMARTSAPPV 80 
153950101   1 MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEDLADQAASGNNMARTSAPPV 80 
170025766   1 MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEGLADQAASGNNMARTSAPPV 80 
186894007   1 MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEDLADQAASGNNMARTSAPPV 80 
51595006    1 MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEDLADQAASGNNMARTSAPPV 80 
108810554   1 MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEGLADQAASGNNMARTSAPPV 80 
108809572   1 MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEGLADQAASGNNMARTSAPPV 80 
45443397   10 MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEGLADQAASGNNMARTSAPPV 89 
22127533   90 TLYQQQPNANDSYPNGNNNNPNGDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAWDNAYIAAAMPLLLLVENIRS 169
218927713  81 TLYQQQPNANDSYPNGNNNNPNGDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAWDNAYIAAAMPLLLLVENIRS 160
162418688  81 TLYQQQPNANDSYPNGNNNNPNGDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAWDNAYIAAAMP-LLLVENIRS 159
145600375  81 TLYQQQPNANDSY-------PNGDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAWDNAYIAAAMPLLLLVENIRS 153
294502609  81 TLYQQQPNANDSYPNGNNNNPNGDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAWDNAYIAAAMPLLLLVENIRS 160
153950101  81 TLYQQQPNANDSYPNGNNNNPNGDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAWDNAYIAAAMPLLLLVENIRS 160
170025766  81 TLYQQQPNANDSYPNGNNNNPNGDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAWDNAYIAAAMPLLLLVENIRS 160
186894007  81 TLYQQQPNANDSYPNGNNNNPNGDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAWDNAYIAAAMPLLLLVENIRS 160
51595006   81 TLYQQQPNANDSYPNGNNNNPNGDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAWDNAYIAAAMPLLLLVENIRS 160
108810554  81 TLYQQQPNANDSYPNGNNNNPNGDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAWDNAYIAAAMPLLLLVENIRS 160
108809572  81 TLYQQQPNANDSYPNGNNNNPNGDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAWDNAYIAAAMPLLLLVENIRS 160
45443397   90 TLYQQQPNANDSYPNGNNNNPNGDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAWDNAYIAAAMPLLLLVENIRS 169
22127533  170 WPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDSYNQSLLVEFHRDAWGGEDCFEHL 249
218927713 161 WPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDSYNQSLLVEFHRDAWGGEDCFEHL 240
162418688 160 WPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDSYNQSLLVEFHRDAWGGEDCFEHL 239
145600375 154 WPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDSYNQSLLVEFHRDAWGGEDCFEHL 233
294502609 161 WPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDSYNQSLLVEFHRDAWGGEDCFEHL 240
153950101 161 WPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDSYNQSLLVEFHRDAWGGEDCFEHL 240
170025766 161 WPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPGSYNQSLLVEFHRDAWGGEDCFEHL 240
186894007 161 WPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDSYNQSLLVEFHRDAWGGEDCFEHL 240
51595006  161 WPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDSYNQSLLVEFHRDAWGGEDCFEHL 240
108810554 161 WPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDSYNQSLLVEFHRDAWGGEDCFEHL 240
108809572 161 WPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDSYNQSLLVEFHRDAWGGEDCFEHL 240
45443397  170 WPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDSYNQSLLVEFHRDAWGGEDCFEHL 249
22127533  250 RVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIF 329
218927713 241 RVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIF 320
162418688 240 RVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIF 319
145600375 234 RVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIF 313
294502609 241 RVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIF 320
153950101 241 RVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIF 320
170025766 241 RVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIF 320
186894007 241 RVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIF 320
51595006  241 RVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIF 320
108810554 241 RVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIF 320
108809572 241 RVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIF 320
45443397  250 RVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIF 329
22127533  330 TYGFALCLCAYGVTAWYLHQQSQQIRSNILTWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRT 409
218927713 321 TYGFALCLCAYGVTAWYLHQQSQQIRSNILTWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRT 400
162418688 320 TYGFALCLCAYGVTAWYLHQQSQQIRSNILTWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRT 399
145600375 314 TYGFALCLCAYGVTAWYLHQQSQQIRSNILTWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRT 393
294502609 321 TYGFALCLCAYGVTAWYLHQQSQQIRSNILTWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRT 400
153950101 321 TYGFALCLCAYGVTAWYLHQQSQQIRSNILTWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRT 400
170025766 321 TYGFALCLCAYGVTAWYLHQQSQQIRSNILTWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRT 400
186894007 321 TYGFALCLCAYGVTAWYLHQQSQQIRSNILTWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRT 400
51595006  321 TYGFALCLCAYGVTAWYLHQQSQQIRSNILTWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRT 400
108810554 321 TYGFALCLCAYGVTAWYLHQQSQQIRSNILTWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRT 400
108809572 321 TYGFALCLCAYGVTAWYLHQQSQQIRSNILTWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRT 400
45443397  330 TYGFALCLCAYGVTAWYLHQQSQQIRSNILTWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRT 409
22127533  410 GEATLSEEFINKKNIERLGLALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAI 489
218927713 401 GEATLSEEFINKKNIERLGLALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAI 480
162418688 400 GEATLSEEFINKKNIERLGLALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAI 479
145600375 394 GEATLSEEFINKKNIERLGLALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAI 473
294502609 401 GEATLSEEFINKKNIERLGLALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAI 480
153950101 401 GEATLSEEFINKKNIERLGLALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAI 480
170025766 401 GEATLSEEFINKKNIERLGLALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAI 480
186894007 401 GEATLSEEFINKKNIERLGLALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAI 480
51595006  401 GEATLSEEFINKKNIERLGLALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAI 480
108810554 401 GEATLSEEFINKKNIERLGLALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAI 480
108809572 401 GEATLSEEFINKKNIERLGLALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAI 480
45443397  410 GEATLSEEFINKKNIERLGLALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAI 489
22127533  490 GRGESDPLADNATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ 545
218927713 481 GRGESDPLADNATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ 536
162418688 480 GRGESDPLADNATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ 535
145600375 474 GRGESDPLADNATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ 529
294502609 481 GRGESDPLADNATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ 536
153950101 481 GRGESDPLADNATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ 536
170025766 481 GRGESDPLADNATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ 536
186894007 481 GRGESDPLADNATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ 536
51595006  481 GRGESDPLADNATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ 536
108810554 481 GRGESDPLADNATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ 536
108809572 481 GRGESDPLADNATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ 536
45443397  490 GRGESDPLADNATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ 545
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap