Conserved Protein Domain Family
PRK06904

?
PRK06904: PRK06904 
replicative DNA helicase; Validated
Statistics
?
PSSM-Id: 136106
View PSSM: PRK06904
Aligned: 5 rows
Threshold Bit Score: 934.411
Threshold Setting Gi: 152979092
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
152979092   1 MARQPSQNLPQERDQQTAQVAIPPHSIEAEQAVLGAIMLNNRHWENVVERVIADDFYLAAHRIIFQEMENLTRQNQPIDL 80 
16273469   34 ISPMASQPQIKSSDKKTAQVSIPPHSTEAEQAVLGGIMLSNQHWDGIAERVIADDFYTFQHRLIFTEMEHLMRNQSPIDL 113
68249840   34 ISPMASQPQIKSSDKKTAQVSIPPHSIEAEQAVLGGIMLSNQHWDGIAERVIADDFYTFQHRLIFTEMEHLMRNQSPIDL 113
113461083   3 KATTGSNQSARIKDKKFEQTLIPPHSIEAEQAVLGGILLDNRYWDSVADQIIAEDFYTFEHRIIFQEIALLFAQNTPVDL 82 
170717658   3 KATTGSNQSARIKDKKFEQTLIPPHSIEAEQAVLGGILLDNRYWDSVADQIIAEDFYTFEHRIIFQEIALLFAQNTPVDL 82 
152979092  81 LTLDQALKNKGIIDDVGGFAYLAELSKNTPSAANINAYSDIVREKAILRDLIGVSNNIAQRAYSPKGKDVKEILDEAERD 160
16273469  114 ITLDQALRSRGVSDEVGGFAYLAELSNNTPNAINILAYADIVREKAILRELISVGNRIAENSYSPKGQDIKLILDEAERE 193
68249840  114 ITLDQALRSHGVSDEVGGFAYLAELSNNTPNAINILAYADIVREKAILRELISVGNRIAENSYSPKGQDIKLILDEAERE 193
113461083  83 LVLDEVLKTKGKSEEVGGFAYLAELSNNTPSAANILTYAEIVREKAILRELISVGNNIVKNAYKPNGQAIKDILDNAERD 162
170717658  83 LVLDEVLKTKGKSEEVGGFAYLAELSNNTPSAANILTYAEIVREKAILRELISVGNNIVKNAYKPNGQAIKDILDNAERD 162
152979092 161 VFTIAEKRTTQNEGPENVVNILERTITKIETLKAMgAGNNGITGVTTGFVDLDKKTAGLQPSDLVIVAARPSMGKTTFAM 240
16273469  194 VFAIAEKRTTSSEGPQNVINVLESTIEKIDILSKL-ENHSGVTGVTTGFTDLDKKTAGLQPSDLIIVAARPSMGKTTFAM 272
68249840  194 VFAIAEKRTTSSEGPQNVINVLESTIEKIDILSKL-ENHSGVTGVTTGFTDLDKKTAGLQPSDLIIVAARPSMGKTTFAM 272
113461083 163 IFSIAEKRTSANEGPQNVINLLFNTIDKIENLAAT-PTNNGVTGVSTGFTALDQKTSGLQKSDLIIVAARPSMGKTTFAM 241
170717658 163 IFSIAEKRTSANEGPQNVINLLFNTIDKIENLAAT-PTNNGVTGVSTGFTALDQKTSGLQKSDLIIVAARPSMGKTTFAM 241
152979092 241 NLCENAAMASDKPVLIFSLEMPADQIMMRTLASLSRVDQTAIRTGQIEDDGDWAKISSTVALLSEKSNMYIDDSAGLTPT 320
16273469  273 NLCENAAMASEKPVLVFSLEMPAEQIMMRMIASLARVDQTKIRTGQNLDEIEWNKIASVVGMFKQKNNLFIDDSSGLTPT 352
68249840  273 NLCENAAMASEKPVLVFSLEMPAEQIMMRMIASLARVDQTKIRTGQNLDEIEWNKIASVVGMFKQKNNLFIDDSSGLTPT 352
113461083 242 NLCENAAMLSEKPVLVFSLEMPAEQILMRMLASLSRVDQVKIRTG-NLTQQDFAKISGTFGMFKQKPNLYIDDSSGLTPT 320
170717658 242 NLCENAAMLSEKPVLVFSLEMPAEQILMRMLASLSRVDQVKIRTG-NLTQQDFAKISGTFGMFKQKPNLYIDDSSGLTPT 320
152979092 321 ELRSRARRVYRERGGLSLIMVDYLQLMRAPGF-DNRTLEIAEISRSLKALAKELEVPVVALSQLNRTLENRTDKRPVNSD 399
16273469  353 DVRSRARRVYRENGGLSMIMVDYLQLMRAPAFsDNRTLEIAEISRSLKALAKELQVPVVALSQLNRTLEQRGDKRPVNSD 432
68249840  353 DVRSRARRVYRENGGLSMIMVDYLQLMRAPAFsDNRTLEIAEISRSLKALAKELQVPVVALSQLNRTLEQRADKRPVNSD 432
113461083 321 ELRSRARRVYRENGGLSLIMVDYLQLMRAPGFeNNRTLEIAEISRSLKALAKELKVPVVALSQLNRTLENRGDRRPINSD 400
170717658 321 ELRSRARRVYRENGGLSLIMVDYLQLMRAPGFeNNRTLEIAEISRSLKALAKELKVPVVALSQLNRTLENRGDRRPINSD 400
152979092 400 LRESGSIEQDADLIMFIYRDEVYHETTEEnKNVAEIIIGKQRNGPIGRVRLTFQGQYSRFDNYAGSLPFDDNY 472
16273469  433 LRESGSIEQDADLIMFIYRDEVYNDNSED-KGVAEIIIGKQRNGPIGRVRLKFNGQFSRFDNLAEQREYRDDY 504
68249840  433 LRESGSIEQDADLIMFIYRDEVYNDNSED-KGVAEIIIGKQRNGPIGRVRLKFNGQFSRFDNLAEQREYRDDY 504
113461083 401 LRESGSIEQDADLIMFIYRDEVYNETTEDnKGIAEIIIGKQRNGPIGTVKLAFQGQYSRFDNLANIPQYYTK- 472
170717658 401 LRESGSIEQDADLIMFIYRDEVYNETTEDnKGIAEIIIGKQRNGPIGTVKLAFQGQYSRFDNLANIPQYYTK- 472
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap