Conserved Protein Domain Family
PRK06893

?
PRK06893: PRK06893 
DnaA regulatory inactivator Hda
Statistics
?
PSSM-Id: 168719
View PSSM: PRK06893
Aligned: 12 rows
Threshold Bit Score: 395.696
Threshold Setting Gi: 148825820
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33151946    1 MQLLLPIHQIDDETLDSFYSENSLLLLDSLRQNFIDVQQPFFYIWGAKSCGKSHLLKAVSNQYLLSQKTASYIPLTKSHY 80 
16273145    3 KQLPLPIHQIDDATLENFYGDNNLLLLDSLRKNSSDLKQPFFYIWGDKGSGKTHLLRAFSNEYLINQRTAIYVPLSKSQY 82 
68250242    3 KQLPLPIHQINDATLENFYGDNNLLLLDSLRKNSSDLKQPFFYIWGDKGSGKTHLLRAFSNEYLINQRTAIYVPLSKSQY 82 
148825820   3 KQLPLPIHQIDDATLENFYGDNNLLLLDSLRKNSSDLKQPFFYIWGDKGSGKTHLLRAFSNEYLINQRTAIYVPLSKSQY 82 
113461486   3 QQLPLPIHQIDDDTLENFCSDNNLLLLSSLRKNFIQLYQPFFYIFGGKSTGKTHLLKACSNYFLASQRNAIYIPLSKAQY 82 
170718408   3 QQLPLPIHQIDDDTLENFCSDNNLLLLGSLRKNFIQLYQPFFYIFGGKSTGKTHLLKACSNYFLASQRNAIYIPLSKAQY 82 
219872144  11 LQLTLPIHQIDDDTFDNFYAENSLLLLGSLRQNFVDVQQPFFYIWGGKSSGKSHLLKAVSNHYLLNQQSATYIPLDKSHY 90 
15601882   26 FQLPLPIHQLDDETLDNFYPDNNLLLLNSLRKNFTCLTQQFFYIWGEQSSGKSHLLKGITHHFFLLQRPAIYVPLEKSQY 105
126208837   1 MQLPLPIHQVDDETFDNFYAENSLVLLDSLRQNFIDVQQPFFYIWGGKSSGKSHLLKAVSNHYLLNQQTSSYIPLEKSQY 80 
52425933    4 HQLPLPIHQIDDETLDNFFVGHNDLLVDSLSKNIACLKQQFFYVWGAEGSGKSHLLKAVSNQFLLQNRPAIYVPLSKSQY 83 
190150693  11 LQLPLPIHQVDDETFDNFYAENSLVLLDSLRQNFIDVQQPFFYIWGGKSSGKSHLLKAVSNHYLLNQQTSSYIPLEKSQY 90 
165976798   1 MQLPLPIHQVDDETFDNFYAENSLVLLDSLRQNFIDVQQPFFYIWGGKSSGKSHLLKAVSNHYLLNQQTSSYIPLEKSQY 80 
33151946   81 FSPLVLDNIEQMDVICLDDLQAIANNEEWELAIFDLFNKIREQqslfnqgHKTLLLISANCSPHQLKIKLPDLKSRLTWG 160
16273145   83 FSTAVLENLEQQELVCLDDLQSVIGNDEWELAIFDLFNRIKAS-------GKTLLLISADKSPSALSVKLPDLNSRLTWG 155
68250242   83 FSTAVLENLEQQELVCLDDLQSVIGNDEWELAIFDLFNRIKAS-------GKTLLLISADKSPSALSVKLPDLNSRLTWG 155
148825820  83 FSTAVLENLEQQELVCLDDLQSVIGNDEWELAIFDLFNQIKAS-------GKTLLLISADKSPSALSVKLPDLNSRLTWG 155
113461486  83 FSPEVLENLEQQELVCLDDFHAIIGNHEWELAIFDLMNRIKES-------GSTLLLISANQSPVNLNISLPDLASRLSWG 155
170718408  83 FSPEVLENLEQQELVCLDDFHAIIGNHEWELAIFDLMNRIKES-------GSTLLLISANQSPVNLNISLPDLASRLSWG 155
219872144  91 FAPTVLDNGDQLDVVCLDDIQAVAGDEEWELAIFDLFNQIREQqglfnqgKKTLLLISADCPPHQLAIHLPDLRSRLTWG 170
15601882  106 FSPAVLENLEQQQLVCLDNLQAIIGNTEWELAIFDLFNRIKSV-------ENTLLVISANQSPTALPVSLPDLASRLRWG 178
126208837  81 FSPMVLDNAEQLDVICLDDIQIVAGNEEWELAIFNLFNLIREQqslfgngHKTLLLISADCPPHQLQINLPDLRSRLTWG 160
52425933   84 FSPAVLENLEYQDAVCLDDLQLVVGNEEWEIAIFDLFNRIKEK-------ENTLLLISANQSPNALPIKLPDLASRLTWG 156
190150693  91 FSPMVLDNAEQLDVICLDDIQIVAGNEEWELAIFNLFNLIREQqslfgngHKTLLLISADCPPHQLQINLPDLRSRLTWG 170
165976798  81 FSPMVLDNAEQLDVICLDDIQIVAGNEEWELAIFNLFNLIREQqslfgngHKTLLLISADCPPHQLQINLPDLRSRLTWG 160
33151946  161 EVYQLYDLTDDQKIVILQRKAYQKGIELSEEVANFLLKRLDRDLPVLLAELDKLDRASLQAKRKLTMPFVKEIIGL 236
16273145  156 EIYQLNSLTDEQKIKVLQLAAYQRGFQLSDETANFLITRLARDMHTLFEALDLLDKASLQAQRNLTIPFVKKILNL 231
68250242  156 EIYQLNSLTDEQKVEVLQHTAYQRGFQLSDETANFLITRLARDMHTLFEALDLLDKASLQAQRNLTIPFVKEILNL 231
148825820 156 EIYQLNSLTDEQKIKVLQLAAYQRGFQLSDETANFLITRLARDMHTLFKALDLLDKASLQAQRNLTIPFVKKILNL 231
113461486 156 EIYQLNPLNEQQKVEVIKRNAHQRGIELPDDTANFLLKRLDRDIKSLFDTLTLLDKASLQAQRKLTIPFVKEILNL 231
170718408 156 EIYQLNPLNEQQKVEVIKRNAHQRGIELPDDTANFLLKRLDRDIKSLFDTLTLLDKASLQAQRKLTIPFVKEILNL 231
219872144 171 EVYRLADLDDEQKRIILQRNARNKGLELSDEVANFLLKRLDRDLQALMHKLMLLDHASLQAQRKLTLPFVKEILGL 246
15601882  179 ESYQLVPLNDQQKIHVLQKNAHQRGIELPDEVANFLLKRLERDMKTLFEALSKLDKASLQAQRKLTIPFVKEILKL 254
126208837 161 EVYQLNDLSDDQKRIILQRNAYQKGMELSDEVANFLLKRLDRDLQTLSTELDRLDRASLQAQRKLTVPFVKEILGL 236
52425933  157 EIYHLNVFTDEEKILVLQRNAHERGIELPDETANFLLKRLDRDMHTLFDALLKLDKASLQAQRKLTIPFVKETLGL 232
190150693 171 EVYQLNDLSDDQKRIILQRNAYQKGMELSDEVANFLLKRLDRDLQTLSTELDRLDRASLQAQRKLTVPFVKEILGL 246
165976798 161 EVYQLNDLSDDQKRIILQRNAYQKGMELSDEVANFLLKRLDRDLQTLSTELDRLDRASLQAQRKLTVPFVKEILGL 236
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap