Conserved Protein Domain Family
PRK06882

?
PRK06882: PRK06882 
acetolactate synthase 3 large subunit
Statistics
?
PSSM-Id: 168717
View PSSM: PRK06882
Aligned: 10 rows
Threshold Bit Score: 1188.95
Threshold Setting Gi: 126208207
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15602735    1 MKKLSGAEMVVQSLRDEGVEFLFGYPGGSVLDIYDAIHTLGGIEHILVRHEQAAVHMADGYARATGKVGCVLVTSGPGAT 80 
16273479    1 MKKLSGAEMVVQSLRDEGVEYVFGYPGGAVLDIYDAIHTLGGIEHILVRHEQAAVHMADGYARSTGKVGCVLVTSGPGAT 80 
68249831    1 MKKLSGAEMVVQSLRDEGVEYVFGYPGGAVLDIYDAIHTLGGIEHILVRHEQAAVHMADGYARSTGKVGCVLVTSGPGAT 80 
148826104   1 MKKLSGAEMVVQSLHDEGVEYVFGYPGGAVLDIYDAIHTLGGIEHILVRHEQAAVHMADGYARSTGKVGCVLVTSGPGAT 80 
219870307   1 --------MIVQSLRDEGVEYVFGYPGGSVLDIYDAIHTLGGIKHVLVRHEQAAVHMADGYARSTGKVGCVLVTSGPGAT 72 
126208207   1 MKKLSGAEMVVQSLKDEGVEYVFGYPGGSVLDIYDAIHTLDNINHVLVRHEQAAVHMADGYARSTGKVGCVLVTSGPGAT 80 
152978711   1 MKKLSGAEMVVQSLRDQGVKYLFGYPGGSVLDIYDAIHTLGGIEHVLVRHEQAAVHMADGYARSTGEVGCVLVTSGPGST 80 
52425374    3 MKKLSGAEMVVQSLRDQGVKYLFGYPGGSVLDIYDAIHTLGGIEHVLVRHEQAAVHMADGYARSTGEVGCVLVTSGPGST 82 
190150039   1 MKKLSGAEMVVQSLKDEGVEYVFGYPGGSVLDIYDAIHTLDNINHVLVRHEQAAVHMADGYARSTGKVGCVLVTSGPGAT 80 
165976143   1 MKKLSGAEMVVQSLKDEGVEYVFGYPGGSVLDIYDAIHTLDNINHVLVRHEQAAVHMADGYARSTGKVGCVLVTSGPGAT 80 
15602735   81 NTITGIATAYMDSVPLIILSGQVMSGLIGSDAFQECDMVGISRPVVKHSFLVKSAAEIPETIKKAFYIASTGRPGPVVID 160
16273479   81 NAITGILTAYTDSVPMVIISGQVMSNLIGSDAFQECDMLGISRPVVKHSFIVKKAEDIPSTLKKAFYIASTGRPGPVVVD 160
68249831   81 NAITGILTAYTDSVPMVIISGQVMSNLIGSDAFQECDMLGISRPVVKHSFIVKKAEDIPSTLKKAFYIASTGRPGPVVVD 160
148826104  81 NAITGILTAYTDSVPMVIISGQVMSNLIGSDAFQECDMLGISRPVVKHSFIVKKAEDIPSTLKKAFYIASTGRPGPVVVD 160
219870307  73 NAITGIATAYTDSIPLVVFSGQVPSSLIGTDAFQECDMVGISRPVVKHSFLVTNPEEIPEIIKKAFYIASTGRPGPVVID 152
126208207  81 NAITGIATAYADSVPLVILTGQVPSALIGTDAFQECDMLGISRPVVKHSFMIKNPEDIPSIIKKAFYIASTGRPSPVLID 160
152978711  81 NAVTGIATAYADSVPLVILTGQVPSNLIGTDAFQECDTIGITRPVVKHSFIIRDPAEIPATIKKAFYIASTGRPGPVVID 160
52425374   83 NAVTGILTAYTDSVPLVIITGQVRSNLIGTDAFQECDTIGLTRPVVKHSFMVKHAEDIPETIKKAFYIASSGRPGPVVID 162
190150039  81 NAITGIATAYADSVPLVILTGQVPSALIGTDAFQECDMLGISRPVVKHSFMIKNPEDIPSIIKKAFYIASTGRPGPVLID 160
165976143  81 NAITGIATAYADSVPLVILTGQVPSALIGTDAFQECDMLGISRPVVKHSFMIKNPEDIPSIIKKAFYIASTGRPGPVLID 160
15602735  161 LPKDVVNPAHKFTYHYPERVELRSYNPTIQGHKGQIKKALKALLVAKKPVLFVGGGVITANCSDKLTQFAQTLNLPVTSS 240
16273479  161 IPKDTVNPNFKYPYEYPEYVELRSYNPTVNGHKGQIKKALKALLVAKKPILFVGGGAITAECSEQLIQFAQRLNLPVTSS 240
68249831  161 IPKDTVNPNFKYPYEYPESVELRSYNPTVNGHKGQIKKALKALLVAKKPILFVGGGAITAECSKQLIQFAQRLNLPVTSS 240
148826104 161 IPKDTVNPNFKYPYEYPEYVELRSYNPTVNGHKGQIKKALKALLVAKKPILFVGGGAITAECSEQLIQFAQRLNLPVTSS 240
219870307 153 VPKDMVNPANKFSYYYPDSVSLRSYNPTLQGHKGQIKKALKVLLVAKKPVLFVGGGTVISESNKELIEFAQKLNLPVTSS 232
126208207 161 IPKDMVNPANKFTYEYPKEVSLRSYNPTVQGHKVQIKKALKALLVAKKPVLYIGGGIISAECATQLTDFATKLNLPVTSS 240
152978711 161 IPKDMVNPANKFTYEYPSEVSMRSYNPNVQGHKGQIKKALKALLVAKKPVLFIGGGVIIDNCSEKVTQFAKLLNLPVTAS 240
52425374  163 IPKDVVNPANKYTYEYPKEVSLRSYNPNVQGHKGQIKKALKALLVAKKPVLFIGGGVIIGNSSEKLTQFAQLLNLPVTSS 242
190150039 161 IPKDMVNPANKFTYEYPKEVSLRSYNPTVQGHKGQIKKALKALLVAKKPVLYIGGGIISAECATQLTDFATKLNLPVTSS 240
165976143 161 IPKDMVNPANKFTYEYPKEVSLRSYNPTVQGHKGQIKKALKALLVAKKPVLYIGGGIISAECATQLTDFATKLNLPVTSS 240
15602735  241 LMGLGAYPSSDKQFLGMLGMHGTYEANNAMHHSDLILGIGVRFDDRTTNNLAKYCPHAKVIHIDIDPTSISKNVLASIPI 320
16273479  241 LMGLGAYPSTDKQFLGMLGMHGTLEANTAMHESDLILGIGVRFDDRTTNNLEKYCPNAKVIHIDIDPTSISKNVPVAIPI 320
68249831  241 LMGLGAYPSTDKQFLGMLGMHGTLEANTAMHESDLILGIGVRFDDRTTNNLEKYCPNAKVIHIDIDPTSISKNVPVAIPI 320
148826104 241 LMGLGAYPSTDKQFLGMLGMHGTLEANTAMHESDLILGIGVRFDDRTTNNLEKYCPNAKVIHIDIDPTSISKNVPVAIPI 320
219870307 233 LMGLGAYPSTDKQFLGMLGMHGTYEANNAMHESDLILGIGVRFDDRTTNNLAKYCPNAKVIHIDIDPTSISKTVPAYIPI 312
126208207 241 LMGLGAFPASNKQFLGMLGMHGTYEANNAMHESDLILGIGVRFDDRTTNNLAKYCPNAKVIHVDIDPASISKTVPAYIPI 320
152978711 241 LMGLGGFPGTDKQWLGMLGMHGTFEANTAMHNADLILGVGVRFDDRTTNNLAKYCPHAKVIHIDIDPTSISKNVSASIPI 320
52425374  243 LMGLGGYPGTDKQFLGMLGMHGTYQANMAMHNADLILGIGVRFDDRTTNNVEKYCPHAKVIHVDIDPTSISKNIAADIPI 322
190150039 241 LMGLGAFPASNKQFLGMLGMHGTYEANNAMHESDLILGIGVRFDDRTTNNLAKYCPNAKVIHVDIDPASISKTVPAYIPI 320
165976143 241 LMGLGAFPASNKQFLGMLGMHGTYEANNAMHESDLILGIGVRFDDRTTNNLAKYCPNAKVIHVDIDPASISKTVPAYIPI 320
15602735  321 VGSAEKVINEFLALLEDDNLlKSQTALDEWWQQIDEWKAVKCLSFTRDDSVIKPQQVMEVVYRLTQGEAYVASDVGQHQM 400
16273479  321 VGNAKNVLEEFLGLLNEEGL-KSQTDLESWWQEINQWKAKKCLEFDRTSGVIKPQQVVEAVYRLTKGQAYVASDVGQHQM 399
68249831  321 VGNAKNVLEEFLGLLNEEGL-KSQTDLESWWQEINQWKAKKCLEFDRTSGVIKPQQVVEAVYRLTKGQAYVASDVGQHQM 399
148826104 321 VGNAKNVLEEFLGLLNEEGL-KSQTDLESWWQEINQWKAKKCLEFDRTSGVIKPQQVVEAVYRLTKGQAYVASDVGQHQM 399
219870307 313 VGDAKFVLEEFLALLSEENLaKGQADLTAWWQQINEWKARQCLRFEQS-DVIKPQQVIQTIYKLTNGDAYIASDVGQHQM 391
126208207 321 VGSAKNVLEEFLSLLEEENLaKNQADLTAWWQQINEWKARQCLNFEVSKDVIKPQQVIRLIHKITNGDAYVASDVGQHQM 400
152978711 321 VGSVDNVFTEFLSLLQDENLmKSQSDLTDWWKRIDEWKAKKCLEFDRTSADIKPQAVVEMIYRLTNGDAYIASDVGQHQM 400
52425374  323 VGSVDNVLTEFLSLLEDDNLsKSQSDLTEWWKQIDEWKAKKCLEFDRTSQAIKPQAVVEAIYRLTKGEAYIASDVGQHQM 402
190150039 321 VGSAKNVLEEFLSLLEEENLaKNQADLTAWWQQINEWKARQCLNFEVSKDVIKPQQVIRLIHKITNGDAYVASDVGQHQM 400
165976143 321 VGSAKNVLEEFLSLLEEENLaKNQADLTAWWQQINEWKARQCLNFEVSKDVIKPQQVIRLIHKITNGDAYVASDVGQHQM 400
15602735  401 FAALHYPFNQPRRWINSGGLGTMGFGLPAALGVKLAYPDSTVVCVTGDGSIQMNIQELSTAQQYDIPIVIISLNNRFLGM 480
16273479  400 FAALHYPFDEPRHWINSGGAGTMGFGFPAALGVKLAHPEGTVVCVTGDGSIQMNIQELSTATQYGIPVVIICLNNHFLGM 479
68249831  400 FAALHYPFDEPRHWINSGGAGTMGFGFPAALGVKLAHPEGTVVCVTGDGSIQMNIQELSTATQYGIPVVIICLNNHFLGM 479
148826104 400 FAALHYPFDEPRHWINSGGAGTMGFGFPAALGVKLAHPEGTVVCVTGDGSIQMNIQELSTATQYGIPVVIICLNNHFLGM 479
219870307 392 FAALYYPFNKPRRWINSGGLGTMGFGLPAAMGVKFAHPEATVVCVTGDGSIQMNIQELSTAKQYDTPVVIVSLNNRFLGM 471
126208207 401 FAALHYPFEKPRRWINSGGAGTMGFGLPAAIGVKFAHPEATVVCVTGDGSIQMNIQELSTAKQYDTPVVIVSLNNRFLGM 480
152978711 401 FTALHHPFDKPRRWINSGGAGTMGFGLPAAIGVKFAHPEHTVVCVTGDGSIQMNIQELSTAMQYNIPIVIVSLNNRFLGM 480
52425374  403 FAALHYPFDKPRHWINSGGAGTMGFGLPAAIGTKFAHPDSRVVCITGDGSIQMNIQELSTAKQYGTPIVIVSLNNRFLGM 482
190150039 401 FAALHYPFEKPRRWINSGGAGTMGFGLPAAIGVKFAHPEATVVCVTGDGSIQMNIQELSTAKQYDTPVVIVSLNNRFLGM 480
165976143 401 FAALHYPFEKPRRWINSGGAGTMGFGLPAAIGVKFAHPEATVVCVTGDGSIQMNIQELSTAKQYDTPVVIVSLNNRFLGM 480
15602735  481 VKQWQDLIYSGRHSQSYMNSLPDFVKLAEAYGHVGIQINTPDELEEKLTQAFSMKDKLVFVDINVDATEHVYPMQVRGGA 560
16273479  480 VKQWQDLIYSGRHSQTYMNSLPDFAKLAESYGHVGIKIATPDELESKLQEAFSIKNKLVFVDINVDESEHVYPMQIRGGA 559
68249831  480 VKQWQDLIYSGRHSQTYMNSLPDFAKLAESYGHVGIKIATPDELESKLQEAFSIKNKLVFVDINVDESEHVYPMQIRGGA 559
148826104 480 VKQWQDLIYSGRHSQTYMNSLPDFAKLAESYGHVGIKIATPDELESKLQEAFSIKNKLVFVDINVDESEHVYPMQIRGGA 559
219870307 472 VKQWQDIIYAGRHSQSYMNSLPDFVKLAEAYGHVGIQINTTDELEEKLAQAFAIKDKLVFVDVLVDETEHVYPMQIRGES 551
126208207 481 VKQWQDLIYSGRHSQVYMNSLPDFAKLAEAYGHVGITIDHPNELEEKLTQAFAIKDKLVFVDVKVDETEHVYPMQIRGGA 560
152978711 481 VKQWQDLIYAGRHSQVYMNSLPDFAKLAEAYGHVGIQIDTADELEEKLTQAFSIKDRLVFVDVRVDATENVYPMQIRGGA 560
52425374  483 VKQWQDLIYSGRHSQVYMNSLPDFAKLAEAYGHVGIQINTADELEEKLTQAFAVKDKLVFVDVLVDATENVYPMQITGGG 562
190150039 481 VKQWQDLIYSGRHSQVYMNSLPDFAKLAEAYDHVGITIDHPNELEEKLTQAFAIKDKLVFVDVKVDETEHVYPMQIRGGA 560
165976143 481 VKQWQDLIYSGRHSQVYMNSLPDFAKLAEAYGHVGITIDHPNELEEKLTQAFAIKDKLVFVDVKVDETEHVYPMQIRGGA 560
15602735  561 MNEMILTKPEKANA 574
16273479  560 MNEMILSKPQEETN 573
68249831  560 MNEMILSKPQEETN 573
148826104 560 MNEMILSKPQEETN 573
219870307 552 MKDMMLSKTERTDA 565
126208207 561 MNEMILSKTERTDA 574
152978711 561 MDEMLLGKPEAK-- 572
52425374  563 MNEMLLGKPAEK-- 574
190150039 561 MNEMILSKTERTDA 574
165976143 561 MNEMILSKTERTDA 574
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap