Conserved Protein Domain Family
PRK06863

?
PRK06863: PRK06863 
single-stranded DNA-binding protein; Provisional
Statistics
?
PSSM-Id: 136097
View PSSM: PRK06863
Aligned: 14 rows
Threshold Bit Score: 275.308
Threshold Setting Gi: 209947525
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
126208261   1 MAGINKVIIVGNLGNDPEMRTMPNGEAVANISVATSESWTDKNTGERREVTEWHRIVFYRRQAEVAGQYLRKGSQVYVEG 80 
190150114   1 MAGINKVIIVGNLGNDPEMRTMPNGEAVANISVATSESWTDKNTGERREVTEWHRIVFYRRQAEVAGQYLRKGSQVYVEG 80 
165976201   1 MAGINKVIIVGNLGNDPEMRTMPNGEAVANISVATSESWTDKNTGERREVTEWHRIVFYRRQAEVAGQYLRKGSQVYVEG 80 
209947525   1 MAGINKVIIVGHLGNDPEMRSMPNGEAVANISVATSEAWTDKNTGERREVTEWHRIVFYRKLDEICGQYLKKGAQVYIEG 80 
16272208    1 MAGINKVIIVGHLGNDPEIRTMPNGDAVANISVATSESWNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEG 80 
68248644    1 MAGINKVIIVGHLGNDPEMRSMPNGEAVANISVATSEAWTDKNTGERREVTEWHRIVFYRKLAEICGQYLKKGAQVYIEG 80 
148825471   1 MAGINKVIIVGHLGNDPEIRTMPNGDAVANISVATSESWNDRNTGERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEG 80 
33152365    1 MAGINKVIIVGNLGNDPEMRTMPNGEAVANISVATSESWTDKNTGERREVTEWHRIVFYRRQAEVAGQYLRKGSQVYVEG 80 
15603815    1 MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG 80 
113461272   1 MAGVNKVIIVGNLGNAPEIRTMPNGDAVANISVATSESWIDKNTNERREITEWHRIVFYRRQAEVAGEYLRKGSKVYVEG 80 
126208261  81 RLKTRKWQDQNGQDRYTTEIQGDVLQMLGGRNQGgdf--ggNQGGWGNS-APAPQQSYNQGNSGYGYDQTASRSAPQAAk 157
190150114  81 RLKTRKWQDQNGQDRYTTEIQGDVLQMLGGRNQGgdf--ggNQGGWGNS-APAPQQSYNQGNSGYGYDQTASRSAPQAAk 157
165976201  81 RLKTRKWQDQNGQDRYTTEIQGDVLQMLGGRNQGgdf--ggNQGGWGNS-APAPQQSYNQGNSGYGYDQTASRSAPQAAk 157
209947525  81 RLRTRKWQDQNGQDRYTTEIQGDVMQMLGTRPQ--------SADGANNS-QP---------------------------- 123
16272208   81 RLKTRKWQDQNGQDRYTTEIQGDVMQMLGGRNQ--------NAGGYGNDmGGAPQSSYQARQTNNGNSYQSSRPAPQQA- 151
68248644   81 RLRTRKWQDQNGQDRYTTEIQGDVMQMLGTRPQ--------SADGANNS-QP---------------------------- 123
148825471  81 RLKTRKWQDQNGQDRYTTEIQGDVMQMLGGRNQ--------NAGGYSNDmGSTPQSSYQARQTNNGGSYQSSRPAPQQS- 151
33152365   81 RLKTRKWQDQNGQDRYTTEIQGDVLQMLGGRNQAgdvathqNQAGW-NA-PASTQNNYNQGASNYNPNQTQAYSAPQTNr 158
15603815   81 RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRNERq------QTGGYAPQ-TAAPQYNAPTGSYGAQPSRPATKP------ 147
113461272  81 RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRSDRg------QMGGY----EPQQQPTYQSH----------SQPKP---- 136
126208261 158 -PAQAEPPMD-NFDDD-IPF 174
190150114 158 -PAQAEPPMD-NFDDD-IPF 174
165976201 158 -PAQAEPPMD-NFDDD-IPF 174
209947525 124 -MPQQDASAN-TFDDS-IPF 140
16272208  152 -APQAEPPMD-GFDDD-IPF 168
68248644  124 -MPQQDASAN-AFDDS-IPF 140
148825471 152 -APQAEPPMD-GFDDD-IPF 168
33152365  159 tKPAAESVMD-NFDDD-IPF 176
15603815  148 -APQNEPPMDmGFEEDnIPF 166
113461272 137 -SIASPSPVDaPLDDD-IPF 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap