Conserved Protein Domain Family
PRK06839

?
PRK06839: PRK06839 
o-succinylbenzoate--CoA ligase
Statistics
?
PSSM-Id: 168698
View PSSM: PRK06839
Aligned: 11 rows
Threshold Bit Score: 895.757
Threshold Setting Gi: 51893328
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51893328   12 VYEISYWVEAQAWMRPDKVALVGSRELWTYRDLHDRVVRLSRAFRNRLGLEPGGRIAIYSGNCLEYLLVLLAASRAGLVL 91 
30261960    1 MQGIAYWIEKRAYLHPDRIAIITEEEEMTYKQLHEYVSKVAAYLIYELNVKKGERIAILSQNSLEYIVLFFAIAKVECIA 80 
49184801    1 MQGIAYWIEKRAYLHPDRIAIITEEEEMTYKQLHEYVSKVAAYLIYELNVKKGERIAILSQNSLEYIVLFFAIAKVECIA 80 
47527224    1 MQGIAYWIEKRAYLHPDRIAIITEEEEMTYKQLHEYVSKVAAYLIYELNVKKGERIAILSQNSLEYIVLFFAIAKVECIA 80 
227815251   1 MQGIAYWIEKRAYLHPDRIAIITEEEEMTYKQLHEYVSKVAAYLIYELNVKKGERIAILSQNSLEYIVLFFAIAKVECIA 80 
229600600   1 MQGIAYWIEKRAYLHPDRIAIITEEEEMTYKQLHEYVSKVAAYLIYELNVKKGERIAILSQNSLEYIVLFFAIAKVECIA 80 
226312168   1 MHGIAYWIEKRARITPTRIAVIANEQSLTYQQMNEQIQRVANYLRHELQVKKGDRIGILSQNSLEYVLLLFAIAKLGAIA 80 
52143488    1 MQGIAYWIEKRAYLHPDRIAIITDEEEMTYKQLHEYVNKVAAYFIYDLHVQKGERIAILSQNSLEYIVLLFAIAKVECIA 80 
218903081   1 MQGIAYWIEKRAYLHPDRIAIITEEEEMTYKQLHEYVSKVAAYLIYELNVKKGERIAILSQNSLEYIVLLFAIAKVECIA 80 
225863891   1 MQGIAYWIEKRAYLHPDRIAIITEEEEMTYKQLHEYVSKVAAYLIYELNVKKGERIAILSQNSLEYIVLLFAIAKVECIA 80 
118477388   1 MQGIAYWIEKRAYLHPDRIAIITEEEEMTYKQLHEYVSKVAAYFIYELNVKKGERIGILSQNSLEYIVLLFAIAKVECIA 80 
51893328   92 VPLNWRLTPGELEYQLRDSGTRRILCSAEYAAAAAELTGRIGLEPPVRITpaaepdslpDLAGLLDAEPSGLEPPGErdp 171
30261960   81 VPLNIRLTENELIFQLKDSGTTVLFVEKTFQNMALSMQKVSYVQRVISIT---------SLKEIEDRKIDNFVEKNE--- 148
49184801   81 VPLNIRLTENELIFQLKDSGTTVLFVEKTFQNMALSMQKVSYVQRVISIT---------SLKEIEDRKIDNFVEKNE--- 148
47527224   81 VPLNIRLTENELIFQLKDSGTTVLFVEKTFQNMALSMQKVSYVQRVISIT---------SLKEIEDRKIDNFVEKNE--- 148
227815251  81 VPLNIRLTENELIFQLKDSGTTVLFVEKTFQNMALSMQKVSYVQRVISIT---------SLKEIEDRKIDNFVEKNE--- 148
229600600  81 VPLNIRLTENELIFQLKDSGTTVLFVEKTFQNMALSMQKVSYVQRVISIT---------SLKEIEDRKIDNFVEKNE--- 148
226312168  81 VPFNIRLTPAELDYQFEDSGIRVLCAQPEFAATIELIKAKASVAHMIWLEpgelpwsqdGPSESSQHSRIDADDGSG--- 157
52143488   81 VPLNIRLTENELIFQLKDSGTTLLFVEETFQNMALSMQKVSYVQSVISIT---------SLKEIEDRKIDNFEEINE--- 148
218903081  81 VPLNIRLTENEIIFQLKDSGTTVLFVEETFQNMALSMQKVSYVQRVISIT---------SLKEIEDRKIDNFVEINE--- 148
225863891  81 VPLNIRLTENELIFQLKDSGTTVLFVEETFQNMALSMQKVSYVQRVISIT---------SLKEIEDRKIDNFVEINE--- 148
118477388  81 VPLNIRLTENELIFQLKDSGTTVLFVEETFQNMALSMQKVSYVQRVISIT---------SLKEIEDRKIDNFVEINE--- 148
51893328  172 qpwDRPLLICYTSGTTGRPKGAVLNSVNMFFNAINNLLTIDLRADDVCITLLPLFHIGGINLFTLPALFAGGRVVVPDRF 251
30261960  149 ---SASFIICYTSGTTGKPKGAVLTQENMFWNALNNTFAIDLTMHDRSIVLLPLFHIGGIGLFAFPTLFAGGVIIVPRKF 225
49184801  149 ---SASFIICYTSGTTGKPKGAVLTQENMFWNALNNTFAIDLTMHDRSIVLLPLFHIGGIGLFAFPTLFAGGVIIVPRKF 225
47527224  149 ---SASFIICYTSGTTGKPKGAVLTQENMFWNALNNTFAIDLTMHDRSIVLLPLFHIGGIGLFAFPTLFAGGVIIVPRKF 225
227815251 149 ---SASFIICYTSGTTGKPKGAVLTQENMFWNALNNTFAIDLTMHDRSIVLLPLFHIGGIGLFAFPTLFAGGVIIVPRKF 225
229600600 149 ---SASFIICYTSGTTGKPKGAVLTQENMFWNALNNTFAIDLTMHDRSIVLLPLFHIGGIGLFAFPTLFAGGVIIVPRKF 225
226312168 158 ---DDPYIICYTSGTTGKPKGAVLTQENMFWNSVHNVAALDLTSEDCSIVLLPLFHIGGIGLFAFPTWLAGGRVVVAGKF 234
52143488  149 ---SASFIICYTSGTTGKPKGAVLTQENMFWNALNNTFAIDLTMHDRSIVLLPLFHIGGIGLFAFPTLFAGGVIIVPRKF 225
218903081 149 ---SASFIICYTSGTTGKPKGAVLTQENMFWNALNNTFAIDLTMHDRSIVLLPLFHIGGIGLFAFPTLFAGGVIIVPRKF 225
225863891 149 ---SASFIICYTSGTTGKPKGAVLTQENMFWNALNNTFAIDLTIHDRSIVLLPLFHIGGIGLFAFPTLFAGGVIIVPRKF 225
118477388 149 ---SASFIICYTSGTTGKPKGAVLTQENMFWNALNNTFAIDLTIHDRSIVLLPLFHIGGIGLFAFPTLFAGGVIIVPRKF 225
51893328  252 DPDQAVRLIQEEKVTVVFGVPTVHQRLLEAIDRLKPDLSHVRMFYSGGAPCPVPLIRAFQERGYRFGQGYGLTETAPTVF 331
30261960  226 EPTKALSMIEKHKVTVVMGVPTIHQALINCSKFETTNLQSVRWFYNGGAPCPEELMREFIDRGFLFGQGFGMTETSPTVF 305
49184801  226 EPTKALSMIEKHKVTVVMGVPTIHQALINCSKFETTNLQSVRWFYNGGAPCPEELMREFIDRGFLFGQGFGMTETSPTVF 305
47527224  226 EPTKALSMIEKHKVTVVMGVPTIHQALINCSKFETTNLQSVRWFYNGGAPCPEELMREFIDRGFLFGQGFGMTETSPTVF 305
227815251 226 EPTKALSMIEKHKVTVVMGVPTIHQALINCSKFETTNLQSVRWFYNGGAPCPEELMREFIDRGFLFGQGFGMTETSPTVF 305
229600600 226 EPTKALSMIEKHKVTVVMGVPTIHQALINCSKFETTNLQSVRWFYNGGAPCPEELMREFIDRGFLFGQGFGMTETSPTVF 305
226312168 235 DPDKAIQLIETHRVTIVMGVPAIHEAIRQSPLFATTSFDSVRWFYNGGAPCPMELIQHFQERGLPFGQGYGLTETSPTVF 314
52143488  226 EPTKALSMIEKHKVTVVMGVPTIHQALINCSKFETTNLQSVRWFYNGGAPCPEELMREFIDRGFLFGQGFGMTETSPTVF 305
218903081 226 EPTKALSMIEKHKVTVVMGVPTIHQALINCSKFETTNLQSVRWFYNGGAPCPEELMREFIDRGFLFGQGFGMTETSPTVF 305
225863891 226 EPTKALSMIEKHKVTVVMGVPTIHQALINCSKFETTNLQSVRWFYNGGAPCPEELMREFIDRGFLFGQGFGMTETSPTVF 305
118477388 226 EPTKALSMIEKHKVTVVMGVPTIHQALINCSKFETTNLQSVRWFYNGGAPCPEELMREFIDRGFLFGQGFGMTETSPTVF 305
51893328  332 MLLEDDFARKPGSIGRPAPFNRVRVIDPATGQpVPPGGVGEITVRGPNVFTAYWQNEKATAEAIRNGWFHTGDLARIDEE 411
30261960  306 MLSEEDARRKVGSIGKPVLFCDYELIDENKNK-VEVGEVGELLIRGPNVMKEYWNRPDATEETIQDGWLCTGDLARVDED 384
49184801  306 MLSEEDARRKVGSIGKPVLFCDYELIDENKNK-VEVGEVGELLIRGPNVMKEYWNRPDATEETIQDGWLCTGDLARVDED 384
47527224  306 MLSEEDARRKVGSIGKPVLFCDYELIDENKNK-VEVGEVGELLIRGPNVMKEYWNRPDATEETIQDGWLCTGDLARVDED 384
227815251 306 MLSEEDARRKVGSIGKPVLFCDYELIDENKNK-VEVGEVGELLIRGPNVMKEYWNRPDATEETIQDGWLCTGDLARVDED 384
229600600 306 MLSEEDARRKVGSIGKPVLFCDYELIDENKNK-VEVGEVGELLIRGPNVMKEYWNRPDATEETIQDGWLCTGDLARVDED 384
226312168 315 MIAKEDARRKAGSIGKPVMFCEVRLISDDGKD-VGQGEIGELLVKGPNVMKEYWNRPEETANTIRDGWLYTGDLARFDEE 393
52143488  306 MLSEEDARRKVGSIGKPVLFCEYELIDENKNK-VEVGEVGELLIRGPNVMKEYWNRPDATEETIQDGWLYTGDLARVDED 384
218903081 306 MLSEEDARRKVGSIGKPVLFCDYELIDENKNK-VEVGEVGELLIRGPNVMKEYWNRPDATEETIQDGWLCTGDLARVDED 384
225863891 306 MLSEEDARRKVGSIGKPVLFCDYELIDENKNK-VEVGEVGELLIRGPNVMKEYWNRPDATEETIQDGWLCTGDLARVDED 384
118477388 306 MLSEEDARRKVGSIGKPVLFCDYELIDENKNK-VEVGEVGELLIRGPNVMKEYWNRPDATEETIQDGWLCTGDLARVDED 384
51893328  412 GFVTIAGRLKEMIISGGENIYPVEVEQAIQTHPAVVEAAVFGVPHPEWGEVPHAAVLLEPGASVTEEELRAHCLARLGKY 491
30261960  385 GFVYIVGRKKEMIISGGENIYPLEVEQVINKLSDVYEVAVVGRQHVKWGEIPIAFIVKKSSSVLIEKDVIEHCRLFLAKY 464
49184801  385 GFVYIVGRKKEMIISGGENIYPLEVEQVINKLSDVYEVAVVGRQHVKWGEIPIAFIVKKSSSVLIEKDVIEHCRLFLAKY 464
47527224  385 GFVYIVGRKKEMIISGGENIYPLEVEQVINKLSDVYEVAVVGRQHVKWGEIPIAFIVKKSSSVLIEKDVIEHCRLFLAKY 464
227815251 385 GFVYIVGRKKEMIISGGENIYPLEVEQVINKLSDVYEVAVVGRQHVKWGEIPIAFIVKKSSSVLIEKDVIEHCRLFLAKY 464
229600600 385 GFVYIVGRKKEMIISGGENIYPLEVEQVINKLSDVYEVAVVGRQHVKWGEIPIAFIVKKSSSVLIEKDVIEHCRLFLAKY 464
226312168 394 GFAYIVGRRKDMIISGGENIYPLELEQVIGELDGVQEAAVVGVPDEKWGEVAKAFIVPKSGAVITEAHIKEHCEQRLAKY 473
52143488  385 GFVYIVGRKKEMIISGGENIYPLEVEQVINKLSDVYEVAVVGRQHVKWGEIPIAFIVKKSSSVLIEKDVIEHCRLFLAKY 464
218903081 385 GFVYIVGRKKEMIISGGENIYPLEVEQVINKLSDVYEVAVVGRQHVKWGEIPIAFIVKKSSSVLIEKDVIEHCRLFLAKY 464
225863891 385 GFVYIVGRKKEMIISGGENIYPLEVEQVINKLSDVYEVAVVGRQHVKWGEIPIAFIVKKSSSVLIEKDVIEHCRLFLAKY 464
118477388 385 GFVYIVGRKKEMIISGGENIYPLEVEQVINKLSDVYEVAVVGRQHVKWGEIPIAFIVKKSSSVLIEKDVIEHCRLFLAKY 464
51893328  492 KIPRRFFILDELPRNAAGKVVKSRLAEITRDM 523
30261960  465 KIPKEIVFLKELPKNATGKIQKAQLVNQLKSR 496
49184801  465 KIPKEIVFLKELPKNATGKIQKAQLVNQLKSR 496
47527224  465 KIPKEIVFLKELPKNATGKIQKAQLVNQLKSR 496
227815251 465 KIPKEIVFLKELPKNATGKIQKAQLVNQLKSR 496
229600600 465 KIPKEIVFLKELPKNATGKIQKAQLVNQLKSR 496
226312168 474 KIPKSFVFLTELPRNATGKIVKQALTRLKTDS 505
52143488  465 KIPKEIVFLKEFPKNATGKIQKAQLTNQLKSR 496
218903081 465 KIPKEIVFLKELPKNATGKIQKAQLVNQLKSR 496
225863891 465 KIPKEIVFLKELPKNATGKIQKAQLVNQLKSR 496
118477388 465 KIPKEIVFLKELPKNATGKIQKAQLVNQLKSR 496
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap