Conserved Protein Domain Family
PRK06824

?
PRK06824: PRK06824 
translation initiation factor Sui1; Validated
Statistics
?
PSSM-Id: 168689
View PSSM: PRK06824
Aligned: 26 rows
Threshold Bit Score: 153.687
Threshold Setting Gi: 120610253
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
120610253   1 MRLSDLGGLVYSTESGRMCPACRQPVAQCACaaaRAAAVPAGDGIVRVSRETKGRGGKAVTVVKGVALPAAELAQLGKQL 80 
77919081    2 TSKKNNSGLVYSTEHGRMCPGCGRPIKQCTCt--GKQTAPPSDGVVRVSRQTKGRKGKGVTLITGVPLGEAGIKALAKRL 79 
229588173   6 ASFAALGGLVFSTDAGRHCPDCRQPVDSCTC---KQTLIPEGDGIARVRRESKGRGGKTVTTITGVPLAEEALKELATTL 82 
34499166    1 MGREKTGGLVYSTEHGRMCPACRLPEAQCQC---KAQAAPAGDGVVRVSRETKGRGGKAVTVVKGLPLAADELAKVGKQL 77 
148262426   3 RDQSQNSRLVYSSELGRICPDCGKSTAGCICr--RKPAQTAGDGIVRVLRESKGRGGKTVTVITGVPLNDEALKALAGEL 80 
197116811   4 TSSNNDAPVVYSSEFGRMCPGCGKPLKDCVCr--KNASAPAGDGVVRLRRETKGRGGKTVIVIAGLPLDADKLTALAGEL 81 
222054351   3 NDEPKNSRLVYSSEHGRICPVCGRPSIACSCk--KNPERASGDGIVRVQRESKGRGGKTVTVITGLPGDDYALKAIAGEL 80 
253699063   4 TNSNNDAPVVYSSEFGRMCPGCGKPLKDCVCr--KNASAPAGDGVVRLRRETKGRGGKTVIVITGLPLDADKLTALAGEL 81 
78224002    3 KGSSSDAPLVWSSEHGRVCPGCGKPAAGCVCk--KQQKSPAGDGIVRVRRESKGRGGKTVTVITGVPLGSDGIAALAGEL 80 
39995797    3 GKSSSGATLVWSSEHGRICSGCGKPVASCSCr--EKGAAPAGDGIVRVRRETKGRGGKTVTVITGVPLNEAGVRELAGEL 80 
120610253  81 KAACGTGGTAKDGVIEVQGDHVERVMQALQALGHKVRRAGG 121
77919081   80 KQRCGSGGTVKDGVIEVQGDHCDLLMEELKKQGWTVKRAGG 120
229588173  83 KKRCGTGGALKDGVIEIQGDHVELLLAELIKLGYKAKKSGG 123
34499166   78 RARCGSGGTVKDWTLEIQGDHVETVVAELARLGFKAKRAGG 118
148262426  81 KRRCGTGGTLKEGSIEIQGDHRELLVIELEKRGYRVKKAGG 121
197116811  82 KRRCGCGGTAKDGIIEIQGDHADVLLAELAKRGYKAKRAGG 122
222054351  81 KRRCGTGGTLKDGNIEIQGDHRDLLVAELEKKGFKVKRAGG 121
253699063  82 KRRCGCGGTVKDGVIEIQGDHADVLLAELVKRGHKAKRAGG 122
78224002   81 KRRCGTGGTVKEGNIEIQGDHADLLVAELTKWGYTVKRAGG 121
39995797   81 KRRCGTGGTVKEGVVEIQGDHADLLVAELTRRGFIVKRAGG 121
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap