Conserved Protein Domain Family
PRK06823

?
PRK06823: PRK06823 
ornithine cyclodeaminase family protein
Statistics
?
PSSM-Id: 136070
View PSSM: PRK06823
Aligned: 18 rows
Threshold Bit Score: 475.417
Threshold Setting Gi: 34498704
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
26989909    1 MRVFSKAQIVAHFNPELAVSQLEEGFIAYSEGKVQVPPVQGFAFKGANGDCCVKSAYIEGSPTFTVKLSTGFYDNPSKGL 80 
148547743   1 MRVFSKAQIIARFNPELAVSQLEEGFIAYSEGKVQVPPVQGFAFKGANGDCCVKSAYIEGSPTFTVKLSTGFYDNPSKGL 80 
170721848   1 MKVFSKQQVTAGLDMELAVQCLEEGFIAFSQGKVQVPPVQAFAFPQANGDCCIKSAHVEGSDTFTVKLSTGFYDNPSKGL 80 
34498704    1 MKLLDKNAIIARFDADHALARVKAGFIAYSRGQVQSAPVQNFHFAGANGDCCVKSAHIAGEEALVVKISTGFYDNPSRGL 80 
218931067   1 MLILNKQKILDKFDADRITLLLKEGFIAFSQQRVQMPPVQHLLFDQANGDCCIKSGYLQGDDQFVVKVSGGFYDNPAQGL 80 
45443721    1 MLILNKQKILDKFDADRITLLLKEGFIAFSQQRVQMPPVQHLLFDQANGDCCIKSGYLQGDDQFVVKVSGGFYDNPAQGL 80 
108808986   1 MLILNKQKILDKFDADRITLLLKEGFIAFSQQRVQMPPVQHLLFDQANGDCCIKSGYLQGDDQFVVKVSGGFYDNPAQGL 80 
108813894   1 MLILNKQKILDKFDADRITLLLKEGFIAFSQQRVQMPPVQHLLFDQANGDCCIKSGYLQGDDQFVVKVSGGFYDNPAQGL 80 
145597331   1 MLILNKQKILDKFDADRITLLLKEGFIAFSQQRVQMPPVQHLLFDQANGDCCIKSGYLQGDDQFVVKVSGGFYDNPAQGL 80 
294505618   1 MLILNKQKILDKFDADRITLLLKEGFIAFSQQRVQMPPVQHLLFDQANGDCCIKSGYLQGDDQFVVKVSGGFYDNPAQGL 80 
26989909   81 PSNDGLMLVLSAHTGQPLALLQDQGWLTAMRTALAGRIAARLLAPSQVKAIGILGTGMQAQMQLEQLRAVTDCRQVIVWG 160
148547743  81 PSNDGLMLVLSAHTGQPLALLQDQGWLTAMRTALAGRIAARLLAPAQVKAIGILGTGMQAQMQLEQLRAVTDCRQVIVWG 160
170721848  81 PSNDGLMLVASASTGQPLALLQDEGWLTCIRTALAGRIAARLLAPANVKAIGILGTGTQARMQLEQLGAVTPCRTVVVWG 160
34498704   81 PSNDGLVLALSATDGRVLALLQDQGWLTTMRTALAGRLVAGLLAPSRVEAIGLLGAGEQARAQLEQLRAVTDCREVRVWS 160
218931067  81 ASNQGVMMAFSAKTGEPQAILLDEGWLTALRTALAGRIVAELCAPQHISALGIVGTGIQARLHLMYLKNVMTCRQLWVWG 160
45443721   81 ASNQGVMMAFSAKTGEPQAILLDEGWLTALRTALAGRIVAELCAPQHISALGIVGTGIQARLHLMYLKNVMTCRQLWVWG 160
108808986  81 ASNQGVMMAFSAKTGEPQAILLDEGWLTALRTALAGRIVAELCAPQHISALGIVGTGIQARLHLMYLKNVMTCRQLWVWG 160
108813894  81 ASNQGVMMAFSAKTGEPQAILLDEGWLTALRTALAGRIVAELCAPQHISALGIVGTGIQARLHLMYLKNVMTCRQLWVWG 160
145597331  81 ASNQGVMMAFSAKTGEPQAILLDEGWLTALRTALAGRIVAELCAPQHISALGIVGTGIQARLHLMYLKNVMTCRQLWVWG 160
294505618  81 ASNQGVMMAFSAKTGEPQAILLDEGWLTALRTALAGRIVAELCAPQHISALGIVGTGIQARLHLMYLKNVMTCRQLWVWG 160
26989909  161 RHERGLAAYTAFARELGFAVHSTQDAAEVAGAANLIVCTTPSRQALLHSDWVQPGTHITAVGADAPGKQELDPALVARAD 240
148547743 161 RHERGLAAYTAFARELGFGVHSTQDAAEVAGAANLIVCTTPSRQALLHSDWVQPGTHITAVGADAPGKQELDPALVARAD 240
170721848 161 RGDAELAAYKTFANDLGYEVQVTRNAAEVAQAANLIVCATPSREPLLQSEWVQPGTHITAVGADAPGKQELDPALVARAD 240
34498704  161 RQPEQAAAFCAFAAQLGFRALAAADPRAVAAEANLIVTATPSRGPLLQRGWIRPGTHITALGADGPGKQELDPAIAADAN 240
218931067 161 RSETALEEYRQYAQAEGFAVNTTLNAAELAHHSQFIVTTTPSREPILQAEDIQPGTHITAVGADSAGKHELSAELVARAD 240
45443721  161 RSETALEEYRQYAQAEGFAVNTTLNAAELAHHSQFIVTTTPSREPILQAEDIQPGTHITAVGADSAGKHELSAELVARAD 240
108808986 161 RSETALEEYRQYAQAEGFAVNTTLNAAELAHHSQFIVTTTPSREPILQAEDIQPGTHITAVGADSAGKHELSAELVARAD 240
108813894 161 RSETALEEYRQYAQAEGFAVNTTLNAAELAHHSQFIVTTTPSREPILQAEDIQPGTHITAVGADSAGKHELSAELVARAD 240
145597331 161 RSETALEEYRQYAQAEGFAVNTTLNAAELAHHSQFIVTTTPSREPILQAEDIQPGTHITAVGADSAGKHELSAELVARAD 240
294505618 161 RSETALEEYRQYAQAEGFAVNTTLNAAELAHHSQFIVTTTPSREPILQAEDIQPGTHITAVGADSAGKHELSAELVARAD 240
26989909  241 RIIVDAIAQCSQYGEVAHALGCGRIDANQLIELGTLLAGRAKGREHDSQITLADLTGVAVQDAQVASHALAALCT 315
148547743 241 RIIVDAIAQCSQYGEVAHALGSGQINAHQLIELGTLLAGRAKGREHDGQITLADLTGVAVQDAQIASYALAALCT 315
170721848 241 RIIVDSLYQCSQYGEVSHALKAGLIVEQQLTELGALLEGRATGREHDAQITLADLTGVAVLDAQISSCVLASLAA 315
34498704  241 VVVADSLAQCAAYGELSHAVKAGLLAPSRIVELGDALASGVRLRQNDEQITLADLTGIAAQDAAIAASVLAPGG- 314
218931067 241 KILVDSIAQCTDFGEVSLAFKQGLLAHHNLTEIGLALAQGIPFRENDQQITLADLTGLGIQDVQIVKGILGDKKG 315
45443721  241 KILVDSIAQCTDFGEVSLAFKQGLLAHHNLTEIGLALAQGIPFRENDQQITLADLTGLGIQDVQIVKGILGDKKG 315
108808986 241 KILVDSIAQCTDFGEVSLAFKQGLLAHHNLTEIGLALAQGIPFRENDQQITLADLTGLGIQDVQIVKGILGDKKG 315
108813894 241 KILVDSIAQCTDFGEVSLAFKQGLLAHHNLTEIGLALAQGIPFRENDQQITLADLTGLGIQDVQIVKGILGDKKG 315
145597331 241 KILVDSIAQCTDFGEVSLAFKQGLLAHHNLTEIGLALAQGIPFRENDQQITLADLTGLGIQDVQIVKGILGDKKG 315
294505618 241 KILVDSIAQCTDFGEVSLAFKQGLLAHHNLTEIGLALAQGIPFRENDQQITLADLTGLGIQDVQIVKGILGDKKG 315
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap