Conserved Protein Domain Family
PRK06813

?
PRK06813: PRK06813 
homoserine dehydrogenase; Validated
Statistics
?
PSSM-Id: 168683
View PSSM: PRK06813
Aligned: 20 rows
Threshold Bit Score: 532.518
Threshold Setting Gi: 28210599
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30262593    1 MKIKVVLSGYGTVGREFIKLLNEKYLYINETYGIDLVVSGVLGRNVAIHNEDGLSIHHLLRYGGGSCAIEKYIEHHPEER 80 
42781685    1 MKIKVVLSGYGTVGREFIKLLHEKCSYIYETYGIELVVSGVLGRNVAIHNEDGLSIHNLLMYGSSSAAIEKYIEYHPEER 80 
30020675    1 MKIQVVLSGYGTVGREFIKLLNEKYSYIYETYGIQLVVSGVLGRNIAIHNEEGLSLHHLLMYGGGTAAIEKYLEYHPKER 80 
52142886    1 MKVKVVLSGYGTVGKEFIKLLNEKYLYINETYGIDLVVSGVLGRNVAIHNEDGLSIHHLLRNGGGSCAIEKYIEHHPEER 80 
222096142   1 MKIKVVLSGYGTVGREFIKLLHEKCSYIYETYGIELVVSGVLGRNVAIHNEDGLSIQDLLTYGSSSAAIEKYIEYHPEER 80 
218897566   1 MKIQVVLSGYGTVGREFIKLLNEKYSYIYETYGIQLVVSGVLGRNIAIHNEDGLSLHHLLMYGGGTAAIEKYLEYHPKER 80 
218235278   1 MKIQVVLSGYGTVGREFIKLLNEKYSYIYETYGIQLVVSGVLGRNIAIHNEDGLSLHHLLMYGGGTAAIEKYLEYHPKER 80 
217960058   1 MKIKVVLSGYGTVGREFIKLLHEKCSYIYETYGIELVVSGVLGRNVAIHNEDGLSIHNLLMYGSSSAAIEKYIEYHPEER 80 
296503142   1 MKIQVVLSGYGTVGREFIKLLNEKYSYIYETYGIQLVVSGVLGRNIAIHNEEGLSLHHLLMYGGGTAAIEKYLEYHPKER 80 
163940475   1 MKIQVVLSGYGTVGKEFIKLLNEKYLYINETYGIDLVVSGVIGRNIAIHNGKGLQINDLLTYGDGSAAIEKYIEHYPEER 80 
30262593   81 ATDNISGTVLVESTVTNLKDGNPGKQYIKQAIEKKMDIVAISKGALVTNWREINEAAKIANVRIRYSGATAAALPTLDIG 160
42781685   81 ATDNISGTVLVESTVTNLKDGNPGKQYIKQAIEKQMDIVAISKGALVTNWREINEAAKIANVRIRYSGATAAALPTLDIG 160
30020675   81 ATTSISGTVLVESTVTNLKDGNPGKQYMKQAIEKQMDIVAISKGALVTNWREINEAAKGANIRIRYSGATAAALPTLDIG 160
52142886   81 ATDNISGTVLVESTVTNLKDGNPGKQYIKQAIEKKMDIVAISKGALVTNWREINEAAKIANVRIRYSGATAAALPTLDIG 160
222096142  81 ATDNISGTVLVESTVTNLKDGNPGKQYIKQAIEKQMDIVAISKGALVTNWREINEAAKIANVRIRYSGATAAALPTLDIG 160
218897566  81 ATTSISGTVLVESTVTNLKDGNPGKQYMKQAIEKQMDIVAISKGALVTNWREINEAARDVNVRIRYSGATAAALPTLDIG 160
218235278  81 ATTSINGTVLVESTVTNLKDGNPGKQYMKQAIEKQMDIVAISKGALVTNWREINVAAKGANIRIRYSGATAAALPTLDIG 160
217960058  81 ATDNISGTVLVESTVTNLKDGNPGKQYIKQAIEKQMDIVAISKGALVTNWREINEAAKIANVRIRYSGATAAALPTLDIG 160
296503142  81 ATTSISGTVLVESTVTNLKDGNPGKQYMKQAIEKQMDIVAISKGALVTNWREINEAAKSANIRIRYSGATAAALPTLDIG 160
163940475  81 GTININGTVLVESTATNLKNGNPGKQYMKQAIENQMDIVAISKGALVTAWSELNTAARISGSRIRYSGATAAALPTLDIG 160
30262593  161 QFSLAGCHIEKIEGILNGTTNYILSKMNEEDIAFEEALKEAQSKGIAETNPILDVSGSDSACKLLLLTNSLMGTENKLTD 240
42781685  161 QFSLAGCHVKKIEGILNGTTNYILTKMNEEDITFEEALKEAQRKGIAETNPILDVSGSDSACKLLLLTNSLMGTEHMLTD 240
30020675  161 QFSLAGCSIEKIEGILNGTTNYILTKMYEEDMTFEEALKEAQNKGIAETNPILDISGSDSACKLLLLTNSLMETEKTLTD 240
52142886  161 QFSLAGCHIEKIEGILNGTTNYILSKMNEEDITFEEALKEAQSKGIAETNPILDVSGSDSACKLLLLTNSLMGTENTLTD 240
222096142 161 QFSLAGCHVEKIEGILNGTTNYILTKMNEENITFEEALKEAQRKGIAETNPILDVSGSDSACKLLLLTNSLMGTEHMLTD 240
218897566 161 QFSLAGCSIEKIEGILNGTTNYILTKMYEEDMTFEEALKEAQNKGIAETNPILDISGSDSACKLLLLTNSLMETEKTLTD 240
218235278 161 QFSLAGCSIEKIEGILNGTTNYILTKMYEEDMTFEEALKEAQNKGIAETNPILDISGSDSACKLLLLTNSLMETEKTLTD 240
217960058 161 QFSLAGCHVEKIEGILNGTTNYILTKMNEEDITFEEALKEAQRKGIAETNPILDVSGSDSACKLLLLTNSLMGTEHMLTD 240
296503142 161 QFSLAGCSIEKIEGILNGTTNYILTKMYEEDMTFEEALKEAQNKGIAETNPILDISGSDSACKLLLLTNSLMETEKTLTD 240
163940475 161 QLSLAGCHIEKIEGILNGTTNYILTKMHEEYKTFEEALQEAQNKGIAETNPLLDISGMDSACKLLLLTNRLMGNDYSLKD 240
30262593  241 IHIKGIEHVTKQQIRNAKEQNKIIKLIASAYKDNEGNVNLNVEPYKLHKNHPLANVNGTEKGITFFTDTMGQVTTIGGAS 320
42781685  241 IYIKGIEHVTKQQIRNAKEQNKFIKLIASAYKDQDGKVTLKVEPYEIDKDHPLANVNGTEKGITFFTDTMGQVTTIGGAS 320
30020675  241 IHIKGIEHVTKQQIRNAKEQHKIIKLIASIYKDEGGNVNLNVEPCQIEKDHPLAKVNGTEKGITFFTDTMGQVTTIGGAS 320
52142886  241 LHIKGIEHVTKQDIGNAKEQNKYIKLIASAYKDEDGNVNLNVEPCEIDKDHPLAKVNGTEKGITFFTDTMGQVTTIGGAS 320
222096142 241 IHIKGIEHVTKQQIRNAKEQNKFIKLIASAYKDEDGNVNLNVEPCEIDKDHPLANVNGTEKGITFFTDTMGQVTTIGGAS 320
218897566 241 IHIKGIEHVTKQQIQNAKEQHKIIKLIASIYKDEGGNVNLNVEPCEIEKDHPLAKVNGTEKGITFFTDTMGQVTTIGGAS 320
218235278 241 IHIKGIEHVTKQQIRNAKEQHKIIKLIASIYKDEGGNVNLNVEPCQIEKNHPLAKVNGTEKGITFFTDTMGQVTTIGGAS 320
217960058 241 IYIKGIEHVTKQQIRNAKEQNKFIKLIASAYKDQDGKVTLKVEPYEIDKDHPLANVNGTEKGITFFTDTMGQVTTIGGAS 320
296503142 241 IHIKGIEHVTKQQIRNAKEQHKIIKLIASTYKDEGGNVNLNVEPCQIEKDHPLAKVNGTEKGITFFTDTMGQVTTIGGAS 320
163940475 241 IKINGIEHVTTQQIQNAKEQNKSIKLIASAYKDDNGKVNLSVQPCNLEKEHPLANINGTEKGITFFTDTMGQVTTIGGAS 320
30262593  321 NPRVAAAAALKDIINLYRKDLSRINR 346
42781685  321 NPRGAAAAALKDIINLYRKDLSLSNR 346
30020675  321 NPRGAAAAALKDVINLYRKDL----- 341
52142886  321 NPRGAAAAALKDIINLYRKDLSRING 346
222096142 321 NPRGAAAAALKDIINLYRKDLSRING 346
218897566 321 NPRGAAAAALKDVINLYRKDL----- 341
218235278 321 NPRGAAAAALKDVINLYRKDL----- 341
217960058 321 NPRGAAAAALKDIINLYRKDLSLSNR 346
296503142 321 NPRGAAAAALKDVINLYRKDL----- 341
163940475 321 NPRGAAAAALKDVINLYRNDL----- 341
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap