Conserved Protein Domain Family
PRK06781

?
PRK06781: PRK06781 
amidophosphoribosyltransferase; Provisional
Statistics
?
PSSM-Id: 136048
View PSSM: PRK06781
Aligned: 29 rows
Threshold Bit Score: 988.358
Threshold Setting Gi: 152974115
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16803808    1 MLAEVKGLNEECGIFGIWDHPNAAEITYYGLHSLQHRGQEGAGIVSTDGEILKGHRNLGLLADVFKHGELDDLKGKAAIG 80 
218895402   1 MLAEIKGLNEECGVFGIWGHENAAQVSYYGLHSLQHRGQEGAGIVVNNGEKIVGHKGLGLISEVFSRGELEGLNGKSAIG 80 
46907998    1 MLAEVKGLNEECGIFGIWDHPNAAEITYYGLHSLQHRGQEGAGIVSTDGETLKGHRNLGLLADVFKHGELDDLKGKAAIG 80 
217964084   1 MLAEVKGLNEECGIFGIWDHPNAAEITYYGLHSLQHRGQEGAGIVSTDGETLKGHRNLGLLADVFKHGELDDLKGKAAIG 80 
226224371   1 MLAEVKGLNEECGIFGIWDHPNAAEITYYGLHSLQHRGQEGAGIVSTDGETLKGHRNLGLLADVFKHGELDDLKGKAAIG 80 
284995354   1 MLAEVKGLNEECGIFGIWDHPNAAEITYYGLHSLQHRGQEGAGIVSTDGETLKGHRNLGLLADVFKHGELDDLKGKAAIG 80 
284802212   1 MLAEVKGLNEECGIFGIWDHPNAAEITYYGLHSLQHRGQEGAGIVSTDGETLKGHRNLGLLADVFKHGELDDLKGKAAIG 80 
16800946    1 MLAEVKGLNEECGIFGIWDHPNAAEITYYGLHSLQHRGQEGAGIVSTDGETLKGHRNLGLLADVFKHGELDDLKGKAAIG 80 
116873202   1 MLAEVKGLNEECGIFGIWDHPNAAEITYYGLHSLQHRGQEGAGIVSTDGETLKGHRNLGLLADVFKHGELDDLKGKAAIG 80 
163938286   1 MLAEIKGLNEECGVFGIWGHENAAQVSYYGLHSLQHRGQEGAGIVVNNGEKIIGHKGLGLISEVFSRGELEGLNGKSAIG 80 
16803808   81 HVRYATAGQKNLGNVQPFLFHFHSSSLALAHNGNLVNAKSLRRELEEEGAIFQTSSDTEVLAHLIKRSHTGDFVEDLKVA 160
218895402  81 HVRYATAGGSEVANVQPLLFRFSDHSMALAHNGNLINAKMLRRELEAEGSIFQTSSDTEVLLHLIKRSTKDSLIESVKEA 160
46907998   81 HVRYATAGQKNLGNVQPFLFHFHSSSLALAHNGNLVNAKSLRRELEEEGAIFQTSSDTEVLAHLIKRSHTGDFVEDLKVA 160
217964084  81 HVRYATAGQKNLGNVQPFLFHFHSSSLALAHNGNLVNAKSLRRELEEEGAIFQTSSDTEVLAHLIKRSHTGDFVEDLKVA 160
226224371  81 HVRYATAGQKNLGNVQPFLFHFHSSSLALAHNGNLVNAKSLRRELEEEGAIFQTSSDTEVLAHLIKRSHTGDFVEDLKVA 160
284995354  81 HVRYATAGQKNLGNVQPFLFHFHSSSLALAHNGNLVNAKSLRRELEEEGAIFQTSSDTEVLAHLIKRSHTGDFVEDLKVA 160
284802212  81 HVRYATAGQKNLGNVQPFLFHFHSSSLALAHNGNLVNAKSLRRELEEEGAIFQTSSDTEVLAHLIKRSHTGDFVEDLKVA 160
16800946   81 HVRYATAGQKNLGNVQPFLFHFHSSSLALAHNGNLVNAKTLRRELEEEGAIFQTSSDTEVLAHLIKRSHTGDFVEDLKVA 160
116873202  81 HVRYATAGQKNLGNVQPFLFHFHSSSLALAHNGNLVNAKSLRRELEEEGAIFQTSSDTEVLAHLIKRSHTGDFVEDLKVA 160
163938286  81 HVRYATAGGSEVANVQPLLFRFSDHSMALAHNGNLINAKMLRRELEAEGSIFQTSSDTEVLLHLIKRSTKDSLIDSVKEA 160
16803808  161 LNKVKGGFAYMLLTEDTMYAALDPNGFRPLSIGRIGDSYVVASETCAFETVGAEFVRDVEPGELIIINDDGLRIEKFTEN 240
218895402 161 LNKVKGAFAYLLLTGNEMIVALDPNGFRPLSIGKMGDAYVVASETCAFDVVGATYIRDVEPGELLIINDEGIHVDRFTND 240
46907998  161 LNKVKGGFAYMLLTEDTMYAALDPNGFRPLSIGRIGDSYVVASETCAFETVGAEFVRDVEPGELIIINDDGLRIEKFTEN 240
217964084 161 LNKVKGGFAYMLLTEDTMYAALDPNGFRPLSIGRIGDSYVVASETCAFETVGAEFVRDVEPGELIIINDDGLRIEKFTEN 240
226224371 161 LNKVKGGFAYMLLTEDTMYAALDPNGFRPLSIGRIGDSYVVASETCAFETVGAEFVRDVEPGELIIINDDGLRIEKFTEN 240
284995354 161 LNKVKGGFAYMLLTEDTMYAALDPNGFRPLSIGRIGDSYVVASETCAFETVGAEFVRDVEPGELIIINDDGLRIEKFTEN 240
284802212 161 LNKVKGGFAYMLLTEDTMYAALDPNGFRPLSIGRIGDSYVVASETCAFETVGAEFVRDVEPGELIIINDDGLRIEKFTEN 240
16800946  161 LNKVKGGFAYMLLTEDTMYAALDPNGFRPLSIGRIGDSYVVASETCAFETVGAEFVRDVEPGELIIINNDGLRIEKFTEN 240
116873202 161 LNKVKGGFAYMLLTEDTMYAALDPNGFRPLSIGRIGDSYVVASETCAFETVGAEFVRDVEPGELIIINNDGLRIEKFTEN 240
163938286 161 LNKVKGAFAYLLLTGNEMIVALDPNGFRPLSIGKMGDAYVVASETCAFDVVGATYIRDVEPGELLIINDEGIHVDRFTNE 240
16803808  241 VKHSICSMEYIYFARPDSNIAGINVHSARKRSGKRLAKEAFIDADVVTGVPDSSISAAIGYAEEAGLPYELGLIKNRYVA 320
218895402 241 VEHAICSMEYIYFARPDSNIAGVNVHAARKNMGKRLAAEAPIEADVVTGVPDSSISAAIGYAEATGIPYELGLIKNRYVG 320
46907998  241 VTHSICSMEYIYFARPDSNIAGINVHSARKRSGKRLAKEAFIDADVVTGVPDSSISAAIGYAEEAGLPYELGLIKNRYVA 320
217964084 241 VTHSICSMEYIYFARPDSNIAGINVHSARKRSGKRLAKEAFIDADVVTGVPDSSISAAIGYAEEAGLPYELGLIKNRYVA 320
226224371 241 VTHSICSMEYIYFARPDSNIAGVNVHSARKRSGKRLAKEAFIDADVVTGVPDSSISAAIGYAEEAGLPYELGLIKNRYVA 320
284995354 241 VTHSICSMEYIYFARPDSNIAGINVHSARKRSGKRLAKEAFIDADVVTGVPDSSISAAIGYAEEAGLPYELGLIKNRYVA 320
284802212 241 VTHSICSMEYIYFARPDSNIAGINVHSARKRSGKRLAKEAFIDADVVTGVPDSSISAAIGYAEEAGLPYELGLIKNRYVA 320
16800946  241 VTHSICSMEYIYFARPDSNIAGINVHSARKRSGKRLAKEAFIDADVVTGVPDSSISAAIGYAEEAGLPYELGLIKNRYVA 320
116873202 241 VTHSICSMEYIYFARPDSNIAGINVHSARKRSGKRLAKEAFIDADVVTGVPDSSISAAIGYAEEAGLPYELGLIKNRYVA 320
163938286 241 VDHAICSMEYIYFARPDSNIAGINVHAARKNMGKRLAAEAPIEADVVTGVPDSSISAAIGYAEATGIPYELGLIKNRYVG 320
16803808  321 RTFIQPSQELREQGVRMKLSAVRGVVEGKRVVMIDDSIVRGTTSKRIVQLLREAGAAEVHVRIASPPLAYPCFYGIDIQT 400
218895402 321 RTFIQPSQELREQGVKMKLSAVRGVVEGKRVVMIDDSIVRGTTSKRIVRMLREAGATEVHVRIASPPLKYPCFYGIDIQT 400
46907998  321 RTFIQPSQELREQGVRMKLSAVRGVVEGKRVVMIDDSIVRGTTSKRIVQLLREAGAAEVHVRIASPPLAYPCFYGIDIQT 400
217964084 321 RTFIQPSQELREQGVRMKLSAVRGVVEGKRVVMIDDSIVRGTTSKRIVQLLREAGAAEVHVRIASPPLAYPCFYGIDIQT 400
226224371 321 RTFIQPSQELREQGVRMKLSAVRGVVEGKRVVMIDDSIVRGTTSKRIVQLLREAGAAEVHVRIASPPLAYPCFYGIDIQT 400
284995354 321 RTFIQPSQELREQGVRMKLSAVRGVVEGKRVVMIDDSIVRGTTSKRIVQLLREAGAAEVHVRIASPPLAYPCFYGIDIQT 400
284802212 321 RTFIQPSQELREQGVRMKLSAVRGVVEGKRVVMIDDSIVRGTTSKRIVQLLREAGAAEVHVRIASPPLAYPCFYGIDIQT 400
16800946  321 RTFIQPSQELREQGVRMKLSAVRGVVEGKRVVMIDDSIVRGTTSKRIVQLLREAGAAEVHVRIASPPLAYPCFYGIDIQT 400
116873202 321 RTFIQPSQELREQGVRMKLSAVRGVVEGKRVVMIDDSIVRGTTSKRIVQLLREAGAAEVHVRIASPPLAFPCFYGIDIQT 400
163938286 321 RTFIQPSQELREQGVKMKLSAVRGVVEGKRVVMIDDSIVRGTTSKRIVRMLREAGATEVHVRIASPPLKYPCFYGIDIQT 400
16803808  401 RNELIASNYSVDEICRIIGADSLEYLSEEGLVDSIGRPYPNEpYGGLCMAYFNGDYPTPLYDYEAEYLASLE 472
218895402 401 RKELIAANNTVEEIREMIGADSLTFLSEDGLVDAIGRPYEGK-YGGLCMAYFNGDYPTALYDYEQELLESMK 471
46907998  401 RNELIASNYSVDEICRIIGADSLEYLSEEGLVDSIGRPYPNEpYGGLCMAYFNGDYPTPLYDYEAEYLASLE 472
217964084 401 RNELIASNYSVDEICRIIGADSLEYLSEEGLVDSIGRPYPNEpYGGLCMAYFNGDYPTPLYDYEAEYLASLE 472
226224371 401 RNELIASNYSVDEICRIIGADSLEYLSEEGLVDSIGRPYPNEpYGGLCMAYFNGDYPTPLYDYEAEYLASLE 472
284995354 401 RNELIASNYSVDEICRIIGADSLEYLSEEGLVDSIGRPYPNEpYGGLCMAYFNGDYPTPLYDYEAEYLASLE 472
284802212 401 RNELIASNYSVDEICRIIGADSLEYLSEEGLVDSIGRPYPNEpYGGLCMAYFNGDYPTPLYDYEAEYLASLE 472
16800946  401 RNELIASNYSVDEICRIIGADSLEYLSEEGLVDSIGKPYPNEpYGGLCMAYFNGDYPTPLYDYEAEYLASLE 472
116873202 401 RNELIASNYSVDEICRIIGADSLEYLSEEGLVDSIGRPYPNEpYGGLCMAYFNGDYPTPLYDYEAEYLASLE 472
163938286 401 RKELIAANNSIEEIRQIIGADSLTFLSEDGLVDAIGRPYEGK-YGGLCMAYFNGDYPTALYDYEQELLESMK 471
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap