Conserved Protein Domain Family
PRK06772

?
PRK06772: PRK06772 
salicylate synthase
Statistics
?
PSSM-Id: 102546
View PSSM: PRK06772
Aligned: 20 rows
Threshold Bit Score: 875.987
Threshold Setting Gi: 218689971
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157145183   1 MKISEFLHLALPEEQWLPTISGVLRQFAEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80 
157145510   1 MKISEFLHLALPEEQWLPTISGVLRQFAEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80 
26248271    1 MKISEFLHLALPEEQWLPTISGVLRQFVEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80 
110642108   1 MKISEFLHLALPEEQWLPTISGVLRQFVEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80 
218695581   1 MKISEFLHLALPEEQWLPTISGVLRQFAEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80 
218699464   1 MKISEFLHLALPEEQWLPTISGVLRQFAEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80 
238895508   1 MKISEFLHLALPEEQWLPTISGVLRQFAEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80 
45441473    1 MKISEFLHLALPEEQWLPTISGVLRQFAEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80 
51595938    1 MKISEFLHLALPEEQWLPTISGVLRQFAEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80 
186895032   1 MKISEFLHLALPEEQWLPTISGVLRQFAEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80 
157145183  81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNAGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
157145510  81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNAGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
26248271   81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNAGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
110642108  81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNAGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
218695581  81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNAGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
218699464  81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNVGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
238895508  81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNAGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
45441473   81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNAGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
51595938   81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNAGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
186895032  81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNAGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
157145183 161 NAPLAVDTALNGEAYKQQVVRAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPE 240
157145510 161 NAPLAVDTALNGEAYKQQVVRAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPE 240
26248271  161 NAPLAVDTALNGEAYKQQVARAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPE 240
110642108 161 NAPLAVDTALNGEAYKQQVARAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPE 240
218695581 161 NAPLAVDTALNGEAYKQQVARAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPE 240
218699464 161 NAPLAVDTALNGETYKQQVARAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPE 240
238895508 161 NAPLAVDTALNGEAYKQQVARAVAEIRRGEYVKVIVSRAIPLPSQIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPE 240
45441473  161 NAPLAVDTALNGEAYKQQVARAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTSVRSFMFRQEGREALGFSPE 240
51595938  161 NAPLAVDTALNGEAYKQQVARAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPE 240
186895032 161 NAPLAVDTALNGEAYKQQVARAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPE 240
157145183 241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
157145510 241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
26248271  241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
110642108 241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
218695581 241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
218699464 241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
238895508 241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
45441473  241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
51595938  241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
186895032 241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
157145183 321 HLGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIENTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRS 400
157145510 321 HLGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIENTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRS 400
26248271  321 HLGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRC 400
110642108 321 HLGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRC 400
218695581 321 HLGSGVSGQLSENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRS 400
218699464 321 HLGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRC 400
238895508 321 HLGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRC 400
45441473  321 HLGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRC 400
51595938  321 HLGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRC 400
186895032 321 HLGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRC 400
157145183 401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
157145510 401 WIQAGAGIIAQSTPERELTETREKLASIAPYLIA 434
26248271  401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
110642108 401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
218695581 401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
218699464 401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
238895508 401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
45441473  401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
51595938  401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
186895032 401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap