Conserved Protein Domain Family
PRK06758

?
PRK06758: PRK06758 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 136035
View PSSM: PRK06758
Aligned: 19 rows
Threshold Bit Score: 211.042
Threshold Setting Gi: 152977290
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30265068    1 MNQSIRYTIAVLFAIIGGTICFWTNNQLGENIIFNGIETLVSASILGGYIFFLFNPEENAQKTMLLTMIGIVGGCISYSM 80 
52140507    1 MNQYIRYTIAVLFAIIGGTICFWTNTQLGENIIFNGIETLVSASILGGYIFFLFNPEENAQKTMLLTMIGIVGGCISYSM 80 
30023060    1 MNQYIRYTIAVLFAIIGGTICFWTNTQLGENIIFNGIETLVSASILGGYIYFLFNPEENAQKTMLLTMIGIVGGCISYSM 80 
163942743   1 MNQYIRYTLAVLFAIVGGVICFWTNTELGENIIFNGIETLVSASILGGYIFFLFNPEENAQKTMLLTMIGIVGGCISYSM 80 
218234726   1 MNQYIRYTIAVLFAIIGGTICFWTNTQLGENIIFNGIETLVSASILGGYIYFLFNPEENAQKTMLLTMIGIVGGCISYSM 80 
218900174   1 MNQYIRYTIAVLFAIIGGTICFWTNTQLGENIIFNGIETLVSASILGGYIYFLFNPEENAQKTMLLTMIGIVGGCISYSM 80 
218906222   1 MNQYIRYTIAVLFAIIGGTICFWTNNQLGENIIFNGIETLVSASILGGYIFFLFNPEENAQKTMLLTMIGIVGGCISYSM 80 
229601100   1 MNQSIRYTIAVLFAIIGGTICFWTNNQLGENIIFNGIETLVSASILGGYIFFLFNPEENAQKTMLLTMIGIVGGCISYSM 80 
225867008   1 MNQYIRYTIAVLFAIIGGTICFWTNNQLGENIIFNGIETLVSASILGGYIFFLFNPEENAQKTMLLTMIGIVGGCISYSM 80 
227817798   1 MNQSIRYTIAVLFAIIGGTICFWTNNQLGENIIFNGIETLVSASILGGYIFFLFNPEENAQKTMLLTMIGIVGGCISYSM 80 
30265068   81 TNYTLPLQLSSAFFHGLWTWFIAFCLADVFNLLQDNEEENGRQIESNS 128
52140507   81 TNYTLPLQLSSAFFHGLWTWFIAFCLADVFNLLQDNEEDNGRQIESNS 128
30023060   81 TNYTLPLQLSSAFFHGLWTWFIAFCLADVFNLLQDNEEDSGRQIESNS 128
163942743  81 TNYTLPLQLSSAFFHGLWTWFIAFCLADVFNLLQDTEEENGRQIESNS 128
218234726  81 TNYTLPLQLSSAFFHGLWTWFIAFCLADVFNLLQDNEEDSGRQIESNS 128
218900174  81 TNYTLPLQLSSAFFHGLWTWFIAFCLADVFNLLQDNEEDSGRQIESNS 128
218906222  81 TNYTLPLQLSSAFFHGLWTWFIAFCLADVFNLLQDNEEENGRQIESNS 128
229601100  81 TNYTLPLQLSSAFFHGLWTWFIAFCLADVFNLLQDNEEENGRQIESNS 128
225867008  81 TNYTLPLQLSSAFFHGLWTWFIAFCLADVFNLLQDNEEENGRQIESNS 128
227817798  81 TNYTLPLQLSSAFFHGLWTWFIAFCLADVFNLLQDNEEENGRQIESNS 128
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap