Conserved Protein Domain Family
PRK06756

?
PRK06756: PRK06756 
flavodoxin; Provisional
Statistics
?
PSSM-Id: 168663
View PSSM: PRK06756
Aligned: 22 rows
Threshold Bit Score: 232.847
Threshold Setting Gi: 226313499
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30019526    1 MSKLVMIFASMSGNTEEMADHIAGVIRETENEIEVIDIMDSPEASILEQYDGIILGAYTWGDGDLPDDFLDFYDAMDSID 80 
42780566    1 MSKLVMIFASMSGNTEEMADHIAGVIRETENEIEVIDIMDSPEASMLEQYDGIILGAYTWGDGDLPDDFLDFYDAMDSID 80 
118476941  20 LSKLVMIFASMSGNTEEMADHIAGVIRETENEIEVIDIMDSPEASILEQYDGIILGAYTWGDGDLPDDFLDFYDAMDSID 99 
163939289   1 MSKLVMIFASMSGNTEEMADHIAGAIRETENEIEVIDIMDTPEASILEQYDGIILGAYTWGDGDLPDDFLDFYDAMDSIN 80 
152974899   1 MSKLVMVFASMSGNTEEMADHIAGAIRETGNEIDVIDIMTTPEASILEEYDGILLGAYTWGDGELPDDFLDFYDEMDKIH 80 
212639306   1 MAKVIMVFTSMTGNTEEMAEAIAEGVREQGAELDVKEVLDA-TATELEEYDGILLGAYTWGDGELPDDFLDFYDELDSVD 79 
217958952   1 MSKLVMIFASMSGNTEEMADHIAGVIRETENEIEVIDIMDSPEASILEQYDGIILGAYTWGDGDLPDDFLDFYDAMDSID 80 
218896406   1 MSKLVMIFASMSGNTEEMADHIAGVIRETENEIEVIDIMDSPEASILEQYDGIILGAYTWGDGDLPDDFLDFYDAMDSID 80 
222095110   1 ----------MSGNTEEMADHIAGVIRETENEIEVIDIMDSPEASILEQYDGIILGAYTWGDGDLPDDFLDFYDAMDSID 70 
296502053   1 -----MIFASMSGNTEEMADHIAGVIRETENEIEVIDIMDSPEASILEQYDGIILGAYTWGDGDLPDDFLDFYDAMDSID 75 
30019526   81 LTGKKAAVFGSCDSAYPKYGVAVDILIEKLQERGAAVVLEGLKVELTPEDEDVEKCLQFGAEFVKHLS 148
42780566   81 LTGKKAAVFGSCDSAYPKYGVAVDILIEKLKERGAEVVLEGLKVELTPEDEDVEKCLQFGAEFVKHLS 148
118476941 100 LTGKKAAVFGSCDSAYPKYGVAVDILIEKLQERGAAVVLEGLKVELTPEDEDVEKCLQFGAEFVKHLS 167
163939289  81 LTGKKAAAFGSCDSAYPKYGVAVDILIEKLQERGAAVVLEGLKVELTPEDEDVEKCLQFGAEFVKHLS 148
152974899  81 LTGKKAAVFGSCDSAYPKYGAAVDILIEKLQERGAEVVLEGLKVELTPEDEDIEKCLQFGIDFIKYLS 148
212639306  80 LTGKKAAVFGSCDSSYEKYGAAVDILIEKLQERGAEVVLDGLKVELTPTNEEKQLCRLFGRDFVKHL- 146
217958952  81 LTGKKAAVFGSCDSAYPKYGVAVDILIEKLKERGAEVVLEGLKVELTPEDEDVEKCLQFGAEFVKHLS 148
218896406  81 LTGKKAAVFGSCDSAYPKYGVAVDILIEKLQERGAAVVLEGLKVELTPEDEDVEKCLQFGAKFVKHLS 148
222095110  71 LTGKKAAVFGSCDSAYPKYGVAVDILIEKLKERGAEVVLEGLKVELTPEDEDVEKCLQFGAEFVKHLS 138
296502053  76 LTGKKAAVFGSCDSAYPKYGVAVDILIEKLQERGAAVVLEGLKVELTPEDEDVEKCLQFGAEFVKHLS 143
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap