Conserved Protein Domain Family
PRK06755

?
PRK06755: PRK06755 
hypothetical protein; Validated
Statistics
?
PSSM-Id: 102532
View PSSM: PRK06755
Aligned: 14 rows
Threshold Bit Score: 410.962
Threshold Setting Gi: 218231078
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42780519    1 MLFFLKKWNELKDVKSELALRDWFYGTKISLSLCTSKEPLTFLVNVEGRDKGLFSEEDFIVVNCMCEPVFENEEKPAAES 80 
52144006    1 MLFFLKKWNELKDVKSELALRDWFYGTKISLSLCTSKEPLTFLVNVEGRDKGLFSEEDFIVVNCMCEPVFENEEKPAAES 80 
49477189    1 MLFFLKKWNELKDVKSELALRDWFYGTKISLSLCTSKEPLTFLVNVEGRDKGLFSEEDFIVVNCMCEPVFENEEKPAVES 80 
118476902   1 MLFFLKKWNELKDVKSELALRDWFYGTKISLSLCTSKEPLTFLVNVEGRDKGLFSEEDFIVVNCMCEPVFENEEKPAVES 80 
163939237   1 MLFFLKKWNELKDVKAELALRDWFYGTKISLSMCTSKEPLTFLVNVEGRDKGVFSEEDFIVVNCMCEPVFENEEKPAIES 80 
217958906   1 MLFFLKKWNELKDVKSELALRDWFYGTKISLSLCTSKEPLTFLVNVEGRDKGLFSEEDFIVVNCMCEPVFENEEKPAAES 80 
218902537   1 MLFFLKKWNELKDVKSELALRDWFYGTKISLSLCTSKEPLTFLVNVEGRDKGLFSEEDFIVVNCMCEPVFENEEKPAVES 80 
222095063   1 MLFFLKKWNELKDVKSELALRDWFYGTKISLSLCTSKEPLTFLVNVEGRDKGLFSEEDFIVVNCMCEPVFENEEKPAAES 80 
225863293   1 MLFFLKKWNELKDVKSELALRDWFYGTKISLSLCTSKEPLTFLVNVEGRDKGLFSEEDFIVVNCMCEPVFENEEKPAVES 80 
301052970   1 MLFFLKKWNELKDVKSELALRDWFYGTKISLSLCTSKEPLTFLVNVEGRDKGLFSEEDFIVVNCMCEPVFENEEKPAVES 80 
42780519   81 FMHADIYKKSSAECILQVQTVDSHLISELYGEKGEVTFDKRSVERVFGKEGITEMTIPIVEDEKKFADLLENNVPNFSEG 160
52144006   81 FMHADIYKKSSAECILQVQTVDSHLISELYGETGEVTFDKRSVERVFGKEGITEMTIPIVEDEKKFANLLENNVPNFIEG 160
49477189   81 FMHADIYKKSRAECILQVQTVDSHLISELYGEEGEVTFDKRSVERVFGKEGITEMTIPIVEDEKKFADLLENNVPNFIEG 160
118476902  81 FMHADIYKKSRAECILQVQTVDSHLISELYGEEGEVTFDKRSVERVFGKEGITEMTIPIVEDEKKFADLLENNVPNFIEG 160
163939237  81 FMHADIYKKSSAECILQVQTVDSHLMSELYGKEGEVTFEKRSVERVFGKDGITEMTIPIVEDEKKFANLLENNVPNFIEG 160
217958906  81 FMHADIYKKSSAECILQVQTVDSHLISELYGEKGEVTFDKRSVERVFGKEGITEMTIPIVEDEKKFADLLENNVPNFIEG 160
218902537  81 FMHADIYKKSRAECILQVQTVDSHLISELYGEEGEVTFDKRSVERVFGKEGITEMTIPIVEDEKKFADLLENNVPNFIEG 160
222095063  81 FMHADIYKKSSAECILQVQTVDSHLISELYGEKGEVTFDKRSVERVFGKEGITEMTIPIVEDEKKFADLLENNVPNFIEG 160
225863293  81 FMHADIYKKSRAECILQVQTVDSHLISELYGEEGEVTFDKRSVERVFGKEGITEMTIPIVEDEKKFADLLENNVPNFIEG 160
301052970  81 FMHADIYKKSRAECILQVQTVDSHLISELYGEEGEVTFDKRSVERVFGKEGITEMTIPIVEDEKKFADLLENNVPNFIEG 160
42780519  161 GGVVLVHNYGMIVWGKTPEYAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
52144006  161 GGVVLVHNYGMIVWGKTPEEAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
49477189  161 GGVVLVHNYGMIVWGKTPEEAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
118476902 161 GGVVLVHNYGMIVWGKTPEEAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
163939237 161 GGVVLVHNYGMIVWGKTPEEAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
217958906 161 GGVVLVHNYGMIVWGKTPEYAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
218902537 161 GGVVLVHNYGMIVWGKTPEEAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
222095063 161 GGVVLVHNYGMIVWGKTPEYAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
225863293 161 GGVVLVHNYGMIVWGKTPEEAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
301052970 161 GGVVLVHNYGMIVWGKTPEEAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap