Conserved Protein Domain Family
PRK06753

?
PRK06753: PRK06753 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 168661
View PSSM: PRK06753
Aligned: 28 rows
Threshold Bit Score: 570.862
Threshold Setting Gi: 222151920
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49477537    2 NNVIIIGGGIAGLCAAISLQKIGLDVKVYDKNTEPTVAGAGIIIAPNAMQALELYGISKKIKKFGNESDGFNLVSKKGTT 81 
27468798    1 MKIAIVGAGIGGLTAAALLEEQGHQVKVFEKNTSINELSAGIGIGDNVLKKLGHHDLAKGIKNAGQNLTAMNIYDEQGTP 80 
70725752    1 MKIAIIGAGIGGLTAGALLLEKGHDVSIFERQSNISEVGAGIGIGDNVIKKLGKHDLAKGIKNAGQNLSAMNVLDDKGNI 80 
224477282   1 MKIAIVGGGIGGLTAAALLHENDNEVHVFEQHNKIEEVGAGIGIGGNVIDKLGNHDLAKGIKNAGQVINELEFLDDHGNI 80 
73661914    1 MKIAIVGAGIGGLTAAALLCEQGHEVKVFEKNSTITEVGAGIGIGGNVIDKLGKHDLAKGIKNIGQVINVMEILDDKDNV 80 
42781295    2 NNVIIIGGGIAGLCAAISLQKIGIEVKVYDKNTEPTVAGTGIIIAPNAMQALEPYGISEKIKKFGNESDGFNLVSEKGTV 81 
52143268    2 NNVIIIGGGIAGLCAAISLQKIGLDVKVYDKNTEPTVAGAGIIIAPNAMQALELYGISKKIKKFGNESNGFNLVSEKGTT 81 
222095801   2 NNVIIIGGGIAGLCAAISLQKIGIEVKVYDKNNEPTVAGAGIIIAPNAMQALELYGISKKIKKFGNESDGFNLVSEKGTT 81 
118477603   2 NNVIIIGGGIAGLCAAISLQKIGLDVKVYDKNTEPTVAGAGIIIAPNAMQALELYGISKKIKKFGNESDGFNLVSEKGTT 81 
222151920   1 MRIGIIGAGIGGLTAAILLERLGHSVEVLEKRHVLKQEGVGLGIGENAIHALERYDIAADIKRDGNILVEAQLRDANDTY 80 
49477537   82 FNKLIIpTCYPKMYSIHRKDLHQLLLSELKEDTVKWGKECVKIEqNEENALKIVFQDGSEALGNILIAADGIHSIVRKQV 161
27468798   81 LMSAKL-KSHSLNVALSRQTLIEIIQSYVEESSIHTGFKVTKIE-QTSCKVTLHFTKQESESFDLCIGADGLHSVVRESV 158
70725752   81 LSAVKL-KEATLNVTLARQTLIELIQSYVNPQCIYTDHDVIKVE-NVEQHTMVHFSNHASQSFDLCIGSDGLHSVVRQAI 158
224477282  81 LNKAYL-KKGTINLTLPRQTLIDIIKSYVPEEAIHTNHKIIRIE-QNSSKVTLTEENGAQSDFDLCIGADGLHSIIRQEL 158
73661914   81 LSKAKL-KKNTVNLTMTRQSLIDVIKSYVSESAIYTNHHVTHVD-NNALKVVMHFEAQEAEAFDLCIGADGLHSNIRHTV 158
42781295   82 FNKLIIpSCYPKMYSIHRKDLHQLLLSELQEDTVEWRKECVKIErNEEDALKIVFQDGSEAFGNILISADGIHSVVRKQV 161
52143268   82 FNKLIIpTCYPKMYSIHRKDLHQLLLSELKEDTVKWGKECVKIEqNEANALKIVFQDGSEALGNILIAADGIHSVIRKQV 161
222095801  82 FNKLIIpTCYPKMYSIHRKDLHQLLLSELKEDTVKWGKECVKIEqNEASALKIVFQDGSEALGNILIAADGIHSVIRKQV 161
118477603  82 FNKLIIpTCYPKMYSIHRKDLHQLLLSELKEDTVKWGKECVKIEqNEANALKIVFQDGSEALGNILIAADGIHSVIRKQV 161
222151920  81 LNRVIFnKAGEDNITIQRSSLHNILRYHYKGN-VRLIKEVVKI--TDFDAGIIKTTDGTSNQYDLVIAADGLHSQVRRQM 157
49477537  162 TQGDNYRYAGYTCWRGVTPTKNLSLTNDFIETWGTNGRFGIVPLPNNEVYWYALINAKARDPKYKAYTTTDLYNHFKTYH 241
27468798  159 GARTKIRYNGYTCFRGMVEDVQFNDQHVANEYWGVKGRVGIVPLINQRAYWFITVHAKEGDPKYQSFGKPHLQAYFNHFP 238
70725752  159 HQNAKILYQGYTCFRGLVDDADLHNIDIASEYWGKRGRVGIVPLINNQAYWFITINASEKDPKYQTFEKPHLQAYFNNYP 238
224477282 159 DPKSTVNYQGYTVFRGMVDDIRLSDPNTAKEYWGPKGRIGIVPMLDNKAYWFISVNAKQGDPKFNDFTKPYIQAYYNHYP 238
73661914  159 APNSKTQYQGYTVFRGLVEDIDIKSDNVAKEYWSAKGRVGVVPLLNNQAYWFISINAKENDATMQSYGKPHLQARFNHFP 238
42781295  162 TQRDNYRYAGYTCWRGITPTNNLSLTNDFIETWGTNGRFGIVPLPNNEVYWYALINAKARDPKYKAYTTEDLYNHFKSYH 241
52143268  162 TQGDNYRYAGYTCWRGVTPANNLSLTNDFIETWGTNGRFGIVPLPNNEVYWYALINAKARDPKYKAYTTTDLYNHFKTYH 241
222095801 162 TQGDNYRYAGYTCWRGVTPANNLSLTNDFIETWGTNGRFGIVPLPNNEVYWYALINAKARDQKYKAYTTTDLYNHFKTYH 241
118477603 162 TQGDNYRYAGYTCWRGVTPANNLSLTNDFIETWGTNGRFGIVPLPNNEVYWYALINAKARDPKYKAYTTTDLYNHFKTYH 241
222151920 158 FPGSEAKYQGYTCFRGTSVNPGLND-KTALEYWDARGRFGIVPLRDNEVYWFLCINALERDTEFRNYNLKKLKRYFEEFP 236
49477537  242 NPIPSILQNASDIDMIHRDIIDITPMKQFFDKRIVFIGDAAHALTPNLGQGACQAIEDAIILAECIkNNAYYRQAFTEFE 321
27468798  239 DEVRKVLERQSETGILLHDIYDLKPLKTFVYGRTILMGDAAHATTPNMGQGASQAMEDAIVLVNCL-EKYDFNKAIERYD 317
70725752  239 EPVRQILDKQSETGIQKHDLYDMKPLKSFVNQRILLLGDAAHATTPNMGQGAGQAMEDAIVLVNCL-AEYDIEKALKRYD 317
224477282 239 NEVRRIFDQTSETGILHHDIYDLTPLKTFVFGRTVLLGDAAHATTPNLGQSAGQAMEDAIVLANCL-KEYDFREALARYD 317
73661914  239 NEVRKVLDKQSETDILLHDIYDLQPLKTFVYQRVILLGDAAHATTPNMGQGAGQAMEDAIVLANCL-QAYPFEAALQRYD 317
42781295  242 NPIPSILHNASDVHMIHRDIVDIMPMNQFFEKRIVFIGDAAHALTPNLGQGACQAIEDAIILAECIkNNAHYRQAFIEYE 321
52143268  242 NPIPSILKNASDIDMIHRDIIDITPMKQFFDKRIVFIGDAAHALTPNLGQGACQAIEDAIILAECIkNNAHYRQAFLEYE 321
222095801 242 NPIPSILKNASDIDMIHRDIIDITPMKQFFDKRIVFIGDAAHALTPNLGQGACQAIEDAIILAECIkNNAHYRQAFLEYE 321
118477603 242 NPIPSILKNASDIDMIHRDIIDITPMKQFFDKRIVFIGDAAHALTPNLGQGACQAIEDAIILAECIkNNAHYRQAFLEYE 321
222151920 237 HAVTNVLDNTVGEP-LHHDIYDIEPLKTFVKGRVVLLGDAAHAATPNMGQGASQAIEDAVCLANQL-EQYPLKEALANYD 314
49477537  322 QKRRDRIEKISNTAWKVGKIAQIESKPLTIVRNKVMKRIPKWISERQAHELYRFHL 377
27468798  318 KLRVKHTAKVIRRSKKIGKMAQKHHKLTVKLRNTAMKLIPNALASAQTKFLYKSKE 373
70725752  318 KLRVKHTAKVIKRSRKIGKIAQKDNKLVISLRNGVMKRTPNRLLSGQTKFLYKAKH 373
224477282 318 KLRVKHTAKVIKKSRKIGKQAQLANGLLVGLRNALMKRLPSKLISSQVKFIYKTKE 373
73661914  318 KIRVDHTKKVIKRSRKIGKLAQRSNKIVISLRNSIAKIMPNRLVAAQTKFIYKSKN 373
42781295  322 QKRRDRIEKISNTAWTVGKMAQIESKPLTIVRNEVMKRIPKWISERQAHELYNFHL 377
52143268  322 QKRRDRIEKISNTAWKVGKMAQIENKPLTLVRNEVMKRMPKWVSEKRTHELYSFHL 377
222095801 322 QKRRDRIEKISNTAWKVGKMAQIESKPLTIVRNEVMKRMPKWVSEKQTHELYSFHL 377
118477603 322 QKRRDRIEKISNTAWKVGKMAQIESKPLTLVRNEVMKRMPKWVSEKRTHELYSFHL 377
222151920 315 RLSVPHTKKVILKSRKIGKAAQSESQLFIQLRNKVVKNIPEYVLNKQTEFLNRRSL 370
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap