Conserved Protein Domain Family
PRK06752

?
PRK06752: PRK06752 
single-stranded DNA-binding protein; Validated
Statistics
?
PSSM-Id: 168660
View PSSM: PRK06752
Aligned: 18 rows
Threshold Bit Score: 221.062
Threshold Setting Gi: 152975402
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30262185    1 MMNRVVLIGRLTKEPELYYTKQGVAYARVCVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCTKGSLVGITGRIHTR 80 
42781293    1 MMNRVVLIGRLTKEPELYYTKQGVAYARVCVAVNRGFRNSLGEQQVDFINCVVWRRSAENVTEYCTKGSLVGITGRIHTR 80 
30020289    1 MMNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIQTS 80 
222095799   1 MMNRVVLIGRLTKEPELYYTKQGVAYARACVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIQTS 80 
218897168   1 MMNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRKSAENVAEYCKKGSLVGITGRIQTS 80 
218232283   1 MMNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIQTS 80 
217959712   1 MMNRVVLIGRLTKEPELYYTKQGVAYARACVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIQTS 80 
225864152   1 MMNRVVLIGRLTKEPELYYTKQGVAYARVCVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIHTR 80 
301053701   1 MMNRVVLIGRLTKEPELYYTKQGVAYARVCVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIHTR 80 
49477535    1 MMNRAVLIGRLTKEPELYYTKQGVAYARVCVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIHTR 80 
30262185   81 NYEDDQGKRIYITEVVIESITFLERRREGASQ 112
42781293   81 NYEDNQGKRIYITEVVIESITFLERRREGAS- 111
30020289   81 NYDDEQGKRIYRTEVVIESITFLERRREGAL- 111
222095799  81 NYDDEQGKRIYRTEVVIESITFLERRREGAS- 111
218897168  81 NYDDEQGKRIYRTEVVIESITFLERRREGAS- 111
218232283  81 NYDNEQGKRIYRTEVVIESITFLERRREGAS- 111
217959712  81 NYDDEQGKRIYRTEVVIESITFLERRREGAS- 111
225864152  81 NYEDDQGKRIYITEVVIESITFLERRREGVSQ 112
301053701  81 NYEDDQGKRIYITEVVIENITFLEKRREGASK 112
49477535   81 NYEDDQGKRIYITEVVIESITFLERRREGASQ 112
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap