Conserved Protein Domain Family
PRK06751

?
PRK06751: PRK06751 
single-stranded DNA-binding protein; Provisional
Statistics
?
PSSM-Id: 168659
View PSSM: PRK06751
Aligned: 20 rows
Threshold Bit Score: 307.881
Threshold Setting Gi: 152977672
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
270000519   4 LMNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTR 83 
47531059    1 -MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTR 79 
42784669    1 -MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTR 79 
52145281    1 -MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTR 79 
222098950   1 -MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTR 79 
218235732   1 MMNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTR 80 
225867454   4 LMNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTR 83 
118480501   4 LMNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTR 83 
296505901   1 -MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTR 79 
163943153   1 MMNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTR 80 
270000519  84 NYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQSSNPFGQSSNSGNQGNQGNSGFTKNDDPFSNV 163
47531059   80 NYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQSSNPFGQSSNSGNQGNQGNSGFTKNDDPFSNV 159
42784669   80 NYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQGSNPFGQSSNS---GNQGNSGFTKNDDPFSNV 156
52145281   80 NYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQSSNPFGQSSNSGNQGNQGNSGFTKNDDPFSNV 159
222098950  80 NYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQSSNPFGQSSNSGNQGNQGNSGFTKNDDPFSNV 159
218235732  81 NYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQGSNPFGQSSNS---GNQGNSGFTKNDDPFSNV 157
225867454  84 NYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQSSNPFGQSSNSGNQGNQGNSGFTKNDDPFSNV 163
118480501  84 NYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQSSNPFGQSSNSGNQGNQGNSGFTKNDDPFSNV 163
296505901  80 NYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQGSNPFGQSSNS---GNQGNSGFTKNDDPFSNV 156
163943153  81 NYDGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQSSNPFGQSSNSGNQGNQGNSGFTKNDDPFSNV 160
270000519 164 GQPIDISDDDLPF 176
47531059  160 GQPIDISDDDLPF 172
42784669  157 GQPIDISDDDLPF 169
52145281  160 GQPIDISDDDLPF 172
222098950 160 GQPIDISDDDLPF 172
218235732 158 GQPIDISDDDLPF 170
225867454 164 GQPIDISDDDLPF 176
118480501 164 GQPIDISDDDLPF 176
296505901 157 GQPIDISDDDLPF 169
163943153 161 GQPIDISDDDLPF 173
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap