Conserved Protein Domain Family
PRK06746

?
PRK06746: PRK06746 
peptide chain release factor 2; Provisional
Statistics
?
PSSM-Id: 75726
View PSSM: PRK06746
Aligned: 17 rows
Threshold Bit Score: 639.472
Threshold Setting Gi: 152977397
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49188023    1 MMGAGFWDDQQGAQAVINEANALKDMVGKFRQLDETFENLEITHELLKEEYDEDLHEELESEVKGLIQEMNEYELQLLLS 80 
227817946  55 MMGAGFWDDQQGAQAVINEANALKDMVGKFRQLDETFENLEITHELLKEEYDEDLHEELESEVKGLIQEMNEYELQLLLS 134
229604792  55 MMGAGFWDDQQGAQAVINEANALKDMVGKFRQLDETFENLEITHELLKEEYDEDLHEELESEVKGLIQEMNEYELQLLLS 134
222098640   1 MMGAGFWDDQQGAQAVINEANALKDMVGSFRQLDETFENLEITHELLKEEYDEDLHEELESEVKGLIQEMNEYELQLLLS 80 
218900306  55 MMSAGFWDDQQGAQAVINEANALKDMVGSFRQLDETFENLEVTHELLKEEYDEDLHEELESEVKGLIQEMNEYELQLLLS 134
217962667  55 MMGAGFWDDQQGAQAVINEANALKDMVGSFRQLDETFENLEITHELLKEEYDEDLHEELESEVKGLIQEMNEYELQLLLS 134
225867150  55 MMGAGFWDDQQGAQAVINEANALKDMVGKFRQLDETFENLEITHELLKEEYDEELHEELESEVKGLIQEMNEYELQLLLS 134
118480225   1 MMGAGFWDDQQGAQAVINEANALKDMVGKFRQLDETFENLEITHELLKEEYDEDLHEELESEVKGLIQEMNEYELQLLLS 80 
296505600   1 MMGAGFWDDQQGAQAVINEANALKDMVGKFRQLDETFENLEITHELLKEEYDEDLHEELESEVKGLIQEMNEYELQLLLS 80 
49478907    1 MMGAGFWDDQQGAQAVINEANALKDMVGKFRQLDETFENLEITHELLKEEYDEDLHEELESEVKGLIQEMNEYELQLLLS 80 
49188023   81 DPYDKNKAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 160
227817946 135 DPYDKNKAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 214
229604792 135 DPYDKNKAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 214
222098640  81 DPYDKNNAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 160
218900306 135 DPYDKNNAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 214
217962667 135 DPYDKNNAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 214
225867150 135 DPYDKNNAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 214
118480225  81 DPYDKNNAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 160
296505600  81 DPYDKNNAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 160
49478907   81 DPYDKNNAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 160
49188023  161 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEVRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 240
227817946 215 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEVRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 294
229604792 215 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEVRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 294
222098640 161 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEIRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 240
218900306 215 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEVRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 294
217962667 215 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEIRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 294
225867150 215 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEVRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 294
118480225 161 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEVRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 240
296505600 161 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEVRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 240
49478907  161 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEVRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 240
49188023  241 IKNREHAMKMLKAKLYQKKLEEQQAELDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 320
227817946 295 IKNREHAMKMLKAKLYQKKLEEQQAELDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 374
229604792 295 IKNREHAMKMLKAKLYQKKLEEQQAELDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 374
222098640 241 IKNREHAMKMLKAKLYQKKLEEQQAELDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 320
218900306 295 IKNREHAMKMLKAKLYQKKLEEQQAQLDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 374
217962667 295 IKNREHAMKMLKAKLYQKKLEEQQAELDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 374
225867150 295 IKNREHAMKMLKAKLYQKKLEEQQAELDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 374
118480225 241 IKNREHAMKMLKAKLYQKKLEEQQAELDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 320
296505600 241 IKNREHAMKMLKAKLYQKKLEEQQAELDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 320
49478907  241 IKNREHAMKMLKAKLYQKKLEEQQAELDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 320
49188023  321 YLRSRI 326
227817946 375 YLRSRI 380
229604792 375 YLRSRI 380
222098640 321 YLRSRI 326
218900306 375 YLRSRI 380
217962667 375 YLRSRI 380
225867150 375 YLRSRI 380
118480225 321 YLRSRI 326
296505600 321 YLRSRI 326
49478907  321 YLRSRI 326
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap